DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural definition of a conserved neutralization epitope on HIV-1 gp120. Structural definition of a conserved neutralization epitope on HIV-1 gp120. Nature 2007 imex curation Zhou T., Xu L., Dey B., Hessell AJ., Van Ryk D., Xiang SH., Yang X., Zhang MY., Zwick MB., Arthos J., Burton DR., Dimitrov DS., Sodroski J., Wyatt R., Nabel GJ., Kwong PD. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zhou T., Xu L., Dey B., Hessell AJ., Van Ryk D., Xiang SH., Yang X., Zhang MY., Zwick MB., Arthos J., Burton DR., Dimitrov DS., Sodroski J., Wyatt R., Nabel GJ., Kwong PD. DIP original experiment: DIP-253254X Nature 2007 IMEx Structural definition of a conserved neutralization epitope on HIV-1 gp120. Structural definition of a conserved neutralization epitope on HIV-1 gp120. Structural definition of a conserved neutralization epitope on HIV-1 gp120. Nature 2007 imex curation Zhou T., Xu L., Dey B., Hessell AJ., Van Ryk D., Xiang SH., Yang X., Zhang MY., Zwick MB., Arthos J., Burton DR., Dimitrov DS., Sodroski J., Wyatt R., Nabel GJ., Kwong PD. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zhou T., Xu L., Dey B., Hessell AJ., Van Ryk D., Xiang SH., Yang X., Zhang MY., Zwick MB., Arthos J., Burton DR., Dimitrov DS., Sodroski J., Wyatt R., Nabel GJ., Kwong PD. DIP original experiment: DIP-253256X Nature 2007 IMEx Structural definition of a conserved neutralization epitope on HIV-1 gp120. Structural definition of a conserved neutralization epitope on HIV-1 gp120. Structural definition of a conserved neutralization epitope on HIV-1 gp120. Nature 2007 imex curation Zhou T., Xu L., Dey B., Hessell AJ., Van Ryk D., Xiang SH., Yang X., Zhang MY., Zwick MB., Arthos J., Burton DR., Dimitrov DS., Sodroski J., Wyatt R., Nabel GJ., Kwong PD. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Zhou T., Xu L., Dey B., Hessell AJ., Van Ryk D., Xiang SH., Yang X., Zhang MY., Zwick MB., Arthos J., Burton DR., Dimitrov DS., Sodroski J., Wyatt R., Nabel GJ., Kwong PD. DIP original experiment: DIP-253255X Nature 2007 IMEx Structural definition of a conserved neutralization epitope on HIV-1 gp120. p04578-pro_0000038427 Surface protein gp120 env Env polyprotein protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR DIP protein P04578-PRO_0000038427 original sequence version: 115 33 511 59E99F4580ABB301 cd4_human T-cell surface glycoprotein CD4 CD4 T-cell surface antigen T4/Leu-3 protein protein human Homo sapiens Human MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWWQAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI DIP protein P01730 original sequence version: 183 DIP protein P01730 original sequence version: 163 DIP protein P01730 original sequence version: 133 DIP protein P01730 original sequence version: 135 DIP protein P01730 original sequence version: 185 DIP protein P01730 original sequence version: 189 20ED893F9E56D236 cd4-env-1 1 4 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 5 unspecified role unspecified role unspecified role unspecified role Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cd4-env-2 3 4 unspecified role unspecified role unspecified role unspecified role human Homo sapiens Human 5 unspecified role unspecified role unspecified role unspecified role Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction cd4-env-3 2 4 unspecified role unspecified role prey prey human Homo sapiens Human 5 unspecified role unspecified role bait bait Region 1-183 Region 1-183 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction