DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Wiper-Bergeron N., Salem HA., Tomlinson JJ., Wu D., Haché RJ. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wiper-Bergeron N., Salem HA., Tomlinson JJ., Wu D., Haché RJ. DIP original experiment: DIP-261098X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Wiper-Bergeron N., Salem HA., Tomlinson JJ., Wu D., Haché RJ. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wiper-Bergeron N., Salem HA., Tomlinson JJ., Wu D., Haché RJ. DIP original experiment: DIP-261099X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Wiper-Bergeron N., Salem HA., Tomlinson JJ., Wu D., Haché RJ. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Wiper-Bergeron N., Salem HA., Tomlinson JJ., Wu D., Haché RJ. DIP original experiment: DIP-261103X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Wiper-Bergeron N., Salem HA., Tomlinson JJ., Wu D., Haché RJ. Only protein-protein interactions in vitro In vitro acetylase assay acetylase assay predetermined predetermined participant predetermined Wiper-Bergeron N., Salem HA., Tomlinson JJ., Wu D., Haché RJ. DIP original experiment: DIP-261096X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Wiper-Bergeron N., Salem HA., Tomlinson JJ., Wu D., Haché RJ. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Wiper-Bergeron N., Salem HA., Tomlinson JJ., Wu D., Haché RJ. DIP original experiment: DIP-261097X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Wiper-Bergeron N., Salem HA., Tomlinson JJ., Wu D., Haché RJ. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Wiper-Bergeron N., Salem HA., Tomlinson JJ., Wu D., Haché RJ. DIP original experiment: DIP-261101X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Wiper-Bergeron N., Salem HA., Tomlinson JJ., Wu D., Haché RJ. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Wiper-Bergeron N., Salem HA., Tomlinson JJ., Wu D., Haché RJ. DIP original experiment: DIP-261102X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Wiper-Bergeron N., Salem HA., Tomlinson JJ., Wu D., Haché RJ. Only protein-protein interactions in vitro In vitro acetylase assay acetylase assay predetermined predetermined participant predetermined Wiper-Bergeron N., Salem HA., Tomlinson JJ., Wu D., Haché RJ. DIP original experiment: DIP-261100X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Glucocorticoid-stimulated preadipocyte differentiation is mediated through acetylation of C/EBPbeta by GCN5. kat2b_human Histone acetyltransferase KAT2B P300/CBP-associated factor PCAF Lysine acetyltransferase 2B Histone acetyltransferase PCAF KAT2B Spermidine acetyltransferase KAT2B protein protein human Homo sapiens Human MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAAAGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK DIP protein Q92831 original sequence version: 159 DIP protein Q92831 original sequence version: 153 DIP protein Q92831 original sequence version: 84 72F516E8BC00CC0C cebpb_mouse CCAAT/enhancer-binding protein beta Cebpb Interleukin-6-dependent-binding protein Liver-enriched transcriptional activator AGP/EBP protein protein mouse Mus musculus Mouse MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERAIDFSPYLEPLAPAADFAAPAPAHHDFLSDLFADDYGAKPSKKPADYGYVSLGRAGAKAAPPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLSTSSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKTVDKLSDEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC DIP protein P28033 original sequence version: 133 DIP protein P28033 original sequence version: 135 DIP protein P28033 original sequence version: 131 827AC4AFC209AE89 kat2a_human Histone acetyltransferase KAT2A Histone acetyltransferase GCN5 STAF97 General control of amino acid synthesis protein 5-like 2 GCN5L2 Lysine acetyltransferase 2A KAT2A GCN5 Histone succinyltransferase KAT2A Histone glutaryltransferase KAT2A protein protein human Homo sapiens Human MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGTGGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK DIP protein Q92830 original sequence version: 156 DIP protein Q92830 original sequence version: 158 728CC8ACF08600EA hdac1_mouse Histone deacetylase 1 Hdac1 protein protein mouse Mus musculus Mouse MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein O09106 original sequence version: 147 DIP protein O09106 original sequence version: 87 DIP protein O09106 original sequence version: 131 DIP protein O09106 original sequence version: 119 DIP protein O09106 original sequence version: 106 DIP protein O09106 original sequence version: 144 DIP protein O09106 original sequence version: 146 DIP protein O09106 original sequence version: 161 DIP protein O09106 original sequence version: 167 DIP protein O09106 original sequence version: 169 DIP protein O09106 original sequence version: 124 DIP protein O09106 original sequence version: 134 DIP protein O09106 original sequence version: 103 DIP protein O09106 original sequence version: 122 7F64D3C17F5E4844 kat2a_mouse Histone acetyltransferase KAT2A Kat2a Gcn5l2 General control of amino acid synthesis protein 5-like 2 Histone acetyltransferase GCN5 Lysine acetyltransferase 2A Histone succinyltransferase KAT2A Histone glutaryltransferase KAT2A protein protein mouse Mus musculus Mouse MAEPSQAPNPVPAAQPRPLHSPAPAPTSTPAPSPASASTPAPTPAPAPAPAAAPAGSTGSGGAGVGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQSEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPATVSATVVPSFSPSMGGGSNSSLSLDSAGTEPMPAGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHSILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK DIP protein Q9JHD2 original sequence version: 46 DIP protein Q9JHD2 original sequence version: 116 DIP protein Q9JHD2 original sequence version: 117 7993CFFEA4734174 cebpb-kat2a-1 6 13 unspecified role unspecified role prey prey in vitro In vitro 10 unspecified role unspecified role bait bait GST-tag GST-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction cebpb-kat2a-2 4 13 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 10 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli acetylation acetylation reaction acetylation cebpb-kat2a-3 3 11 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 10 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction cebpb-hdac1-1 2 12 unspecified role unspecified role prey prey mouse Mus musculus Mouse 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse 10 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association cebpb-kat2b-1 5 9 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 10 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction cebpb-kat2a-4 7 13 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 10 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction cebpb-kat2b-2 8 9 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 10 enzyme target enzyme target substrate substrate unspecified role unspecified role ecolx Escherichia coli acetylation acetylation reaction acetylation cebpb-kat2a-5 1 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse 10 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association