DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu RPA-like proteins mediate yeast telomere function. RPA-like proteins mediate yeast telomere function. Nature structural & molecular biology 2007 imex curation Gao H., Cervantes RB., Mandell EK., Otero JH., Lundblad V. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Gao H., Cervantes RB., Mandell EK., Otero JH., Lundblad V. DIP original experiment: DIP-66666X Nature structural & molecular biology 2007 IMEx RPA-like proteins mediate yeast telomere function. RPA-like proteins mediate yeast telomere function. RPA-like proteins mediate yeast telomere function. Nature structural & molecular biology 2007 imex curation Gao H., Cervantes RB., Mandell EK., Otero JH., Lundblad V. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gao H., Cervantes RB., Mandell EK., Otero JH., Lundblad V. DIP original experiment: DIP-66665X Nature structural & molecular biology 2007 IMEx RPA-like proteins mediate yeast telomere function. RPA-like proteins mediate yeast telomere function. RPA-like proteins mediate yeast telomere function. Nature structural & molecular biology 2007 imex curation Gao H., Cervantes RB., Mandell EK., Otero JH., Lundblad V. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gao H., Cervantes RB., Mandell EK., Otero JH., Lundblad V. DIP original experiment: DIP-66664X Nature structural & molecular biology 2007 IMEx RPA-like proteins mediate yeast telomere function. RPA-like proteins mediate yeast telomere function. RPA-like proteins mediate yeast telomere function. Nature structural & molecular biology 2007 imex curation Gao H., Cervantes RB., Mandell EK., Otero JH., Lundblad V. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gao H., Cervantes RB., Mandell EK., Otero JH., Lundblad V. DIP original experiment: DIP-66667X Nature structural & molecular biology 2007 IMEx RPA-like proteins mediate yeast telomere function. cdc13_yeast Cell division control protein 13 CDC13 YDL220C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDTLEEPECPPHKNRIFVSSSKDFEGYPSKAIVPVQFVALLTSIHLTETKCLLGFSNFERRGDQSQEDQYLIKLKFKDRGSERLARITISLLCQYFDIELPDLDSDSGASPTVILRDIHLERLCFSSCKALYVSKHGNYTLFLEDIKPLDLVSVISTISTKSTNSSKHSSSELISECDLNNSLVDIFNNLIEMNRDEKNRFKFVKLIHYDIELKKFVQDQQKVLSQKSKAAAINPFFVPNRLGIPYIESQNEFNSQLMTLNVDEPTTDISNMGEEMHDSADPIEDSDSSTTSSTGKYFSSKSYIQSQTPERKTSVPNNWHDDDSGSKRKRKLSFHSPNASSIRKAISYEQLSLASVGSVERLEGKIVGMNPPQFASINEFKYCTLKLYFTQLLPNVPDKVLVPGVNCIEIVIPTRERICELFGVLNCQSDKISDILLLEKPDRISVEVERILWDNDKTASPGMAVWSLKNISTDTQAQAQVQVPAQSSASIDPSRTRMSKMARKDPTIEFCQLGLDTFETKYITMFGMLVSCSFDKPAFISFVFSDFTKNDIVQNYLYDRYLIDYENKLELNEGFKAIMYKNQFETFDSKLRKIFNNGLRDLQNGRDENLSQYGIVCKMNIKVKMYNGKLNAIVRECEPVPHSQISSIASPSQCEHLRLFYQRAFKRIGESAISRYFEEYRRFFPIHRNGSHLAKLRFDEVKHEPKKSPTTPALAEHIPDLNADVSSFDVKFTDISSLLDSSARLPRPQQTHKSNTLYSCEGRIIAIEYHASDLCFHITNELPLLQTRGLAPERVLQLHIITSKNFAYFFNRSSAYLQRQPLEEKYTQLAQFLGHSFKFNITSSLTLFPDTTVALQIWCPIECTFRELQQQLAHPKVAAAPDSGSLDCAINATVNPLRLLAAQNGVTVKKEEDNDDDAGAVPTS 9FE0AD08520A6F8A 9FE0AD08520A6F8A stn1_yeast Protein STN1 STN1 D4456 YD8554.15 YDR082W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDKYGHIAHQEGDVCYYIPRLFKYNSYYSGTEDVRIFVGDLKYRMRVSLQICEKYYDRRLSMLFWKNHPLQQIHLIGCIIGLQFKWIGKQEYIFFQLDDCTSDSSLVGYTSDMRFLTCKVKKDSILSWGLNITDLIGLTLHVYGQASLNYQELQVEYLRLCYSLTEEIDHWKITMNMREQLDTPWSLSDFVIGELFTQEQEWTPETSQIEVVNPDFVGIGYKTPESKRNETTFIEQLQEERLKDELEIISPYNSTDTSNSVHSLSFRFVSSLKDFPETHFLNSGDQIDNGNDEQLKKLEYQSANLPVMIPNRTSAKSNLMLILLGLQMKEISNSDLYKLKEVRSVVTSLASFLFQQQNVGVMKSFDSLEKEAFRDLVNRLVSQGLIGLKDKTSETFDLLPLKNLFEYAEKRISVLMKLQCYTGTVQLSHVQEKLHLPYITTNGIVDVFKECLKRTKKQYPEVLKNWWIDLDPKNGMEDQNSGILLHLEYAAAYS 61B691C8D4A2E650 61B691C8D4A2E650 ten1_yeast Telomere length regulation protein TEN1 TEN1 Protein telomeric pathways with STN1 YLR010C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQLVLDLKCLKDKIATNYDIHNNVYGGNGMEPNIIHPSKRFRIVVRLVDFLFCKSDEEFIKGFFCQMIVRNLHCLNSTNGAEEMRLYMSERLFSAHKDDLRLINGQVLDVRIGVWYGIHQSPPIFEIIDFKILSRNDVRDFCEFVKSPLGEKFLNISNS 0D8152451821E2CE 0D8152451821E2CE cdc13-stn1-6 3 6 unspecified role unspecified role prey prey 288-494 binding region 288-494 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ten1-stn1-8 2 7 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey 5-172 binding region 5-172 binding region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association stn1-ten1-5 1 7 unspecified role unspecified role prey prey in vitro In vitro 6 unspecified role unspecified role bait bait FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro direct interaction direct interaction stn1-ten1-6 4 7 unspecified role unspecified role prey prey ecolx Escherichia coli 6 unspecified role unspecified role bait bait 64-199 binding region 64-199 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction