DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Common mechanisms of target cell recognition and immunity for class II bacteriocins. Common mechanisms of target cell recognition and immunity for class II bacteriocins. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Diep DB., Skaugen M., Salehian Z., Holo H., Nes IF. Only protein-protein interactions laclm Lactococcus lactis subsp. cremoris (strain MG1363) anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Diep DB., Skaugen M., Salehian Z., Holo H., Nes IF. DIP original experiment: DIP-261063X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Common mechanisms of target cell recognition and immunity for class II bacteriocins. Common mechanisms of target cell recognition and immunity for class II bacteriocins. Common mechanisms of target cell recognition and immunity for class II bacteriocins. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Diep DB., Skaugen M., Salehian Z., Holo H., Nes IF. Only protein-protein interactions lacla Lactococcus lactis subsp. lactis (strain IL1403) Streptococcus lactis anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Diep DB., Skaugen M., Salehian Z., Holo H., Nes IF. DIP original experiment: DIP-261062X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Common mechanisms of target cell recognition and immunity for class II bacteriocins. q9cex7_lacla ptnC L146623 protein protein lacla Lactococcus lactis subsp. lactis (strain IL1403) Streptococcus lactis MEYGVLSVILVIVVAFLAGLEGILDQWQFHQPIIACSLIGIVTGHASAGIILGGSLQLIALGWANVGAAVAPDAALASIASSILMVQSNNFDLTHIMGTIVPAAILLATAGLVLTTLVRMLSVVLVHQADRAAENGSYSGVEMWHFIALICQGLRIAIPAGLLLVISPDAIQKALAAIPPVISGGLAVGGGMVVAVGYAMVINLMATREVWPFFFLGFALAPISELTLIATGVLGVVIAIVYLNLQASGGSGNGTASSSGDPIGDILNDY DIP protein Q9CEX7 original sequence version: 55 q9cex6_lacla ptnD L147466 protein protein lacla Lactococcus lactis subsp. lactis (strain IL1403) Streptococcus lactis MSENKVTLDKKIRRSVMWRSMFLQGSWNYERMQNGGWAYSLIPALKKLYPSGEEAKEALKRHLEFFNTHPYVAAPIIGVTLALEEERANGADIDDAAIQGVKVGMMGPLAGIGDPVFWFTVRPIVGAIAASLATGGSIIAPLFFFIVWNAIRIAFLWYTQEFGYKSGSAITKDLGGGLLQTVTKGASILGMFVLGVLIQRWVTINFNGPNAVVSKIPLQKGAYLEFPKGSVSGTQLHDILGQVGNKLSLDPTKVTYLQDNLNQLIPGLAGLLITFLCMWLLKKKVSPIVIIFGLFVVGILGRWAQIM DIP protein Q9CEX6 original sequence version: 57 a2rj82_laclm EIIAB-Man EIII-Man Mannose-specific phosphotransferase enzyme IIA component Mannose-specific phosphotransferase enzyme IIB component PTS system mannose-specific EIIA component PTS system mannose-specific EIIAB component PTS system mannose-specific EIIB component llmg_0729 ptnAB protein protein laclm Lactococcus lactis subsp. cremoris (strain MG1363) MSIGIVIASHGEFAAGIKQSGSMIFGEQEKVQVVTFMPSEGPTDLHAKIEAAIATFDAEDEVLVLADLWSGSPFNQASAVMGENPERKIAIITGLNLPMLIQAYTERMMDASAGVDKVVANIMKEAKGGIKVLPEELQPAEETAVAAAPAAVQGAIPEGTVIGDGKIKINLARIDSRLLHGQVATAWTPDSRANRIIVVSDTVSKDELRKKLIEQAAPTGVKANVIPIKKMIEVAKDPRFGDTKALLLFETPQDALATIEGGVPIDTLNVGSMAHSTGKTMLNKVLSMDKDDVATFEKLRDLGVKFDVRKVPADSKSDLFGLIKKANVQ DIP protein A2RJ82 original sequence version: 43 lcia_lacll Lactococcin-A immunity protein lciA protein protein lacll Lactococcus lactis subsp. lactis Streptococcus lactis MKKKQIEFENELRSMLATALEKDISQEERNALNIAEKALDNSEYLPKIILNLRKALTPLAINRTLNHDLSELYKFITSSKASNKNLGGGLIMSWGRLF DIP protein P0A3M7 original sequence version: 13 q9cex8_lacla EIIAB-Man Mannose-specific phosphotransferase enzyme IIA component Mannose-specific phosphotransferase enzyme IIB component PTS system mannose-specific EIIA component PTS system mannose-specific EIIAB component PTS system mannose-specific EIIB component L1762179 EIII-Man ptnAB protein protein lacla Lactococcus lactis subsp. lactis (strain IL1403) Streptococcus lactis MSIGIVIASHGEFAAGIKQSGSMIFGEQEKVQVVTFMPSEGPTDLHAKIEAAIATFDAEDEVLVLADLWSGSPFNQASAVMGENPERKIAIITGLNLPMLIQAYTERMMDASAGVDKVVANIMKEAKGGIKVLPEELQPAEETAVAAAPAAVQGAIPEGTVIGDGKIKINLARIDSRLLHGQVATAWTPDSRANRIIVVSDTVSKDELRKKLIEQAAPTGVKANVIPIKKMIEVAKDPRFGDTKALLLFETPQDALATIEGGVPIETLNVGSMAHSTGKTMLNKVLSMDKDDVATFEKLRDLGVKFDVRKVPADSKSDLFGLINKADVQ DIP protein Q9CEX8 original sequence version: 69 a2rj81_laclm ptnC llmg_0728 protein protein laclm Lactococcus lactis subsp. cremoris (strain MG1363) MEYGVLSVILVILVAFLAGLEGILDQWQFHQPIIACSLIGIVTGHASAGIILGGSLQLIALGWANVGAAVAPDAALASIASSILMVQSNNFDLTHIMGTIVPAAILLATAGLVLTTLVRMLSVVLVHQADRAAENGSYSGVEMWHFIALICQGLRIAIPAGLLLVISPEAIQNALAAIPPVISGGLAVGGGMVVAVGYAMVINLMATREVWPFFFLGFALAPISELTLIATGVLGVVIAIVYLNLQSSGGSGNGTASSSGDPIGDILNDY DIP protein A2RJ81 original sequence version: 36 a2rj80_laclm ptnD llmg_0727 protein protein laclm Lactococcus lactis subsp. cremoris (strain MG1363) MSDKKVTLDKKIRRSVMWRSMFLQGSWNYERMQNGGWAYSLIPALKKLYPSGEEAKEALKRHLEFFNTHPYVAAPIIGVTLALEEERANGADIDDAAIQGVKVGMMGPLAGIGDPVFWFTVRPIVGAIAASLAVGGSIIAPLFFFIVWNAIRIAFLWYTQEFGYKSGSAITKDLGGGLLQTVTKGASILGMFVLGVLIQRWVTTNFNGANAVVSKIPLQKGAYVEFPKGSVSGTQLHEILGQVGNKLSLDPTKVTYLQDNLNQLIPGLAGLLITFLCMWLLKKKVSPIVIIFGLFIVGILGRWAQIM DIP protein A2RJ80 original sequence version: 37 lcia-ptnab-1 2 6 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range lacla Lactococcus lactis subsp. lactis (strain IL1403) Streptococcus lactis 3 unspecified role unspecified role prey prey lacla Lactococcus lactis subsp. lactis (strain IL1403) Streptococcus lactis 4 unspecified role unspecified role prey prey lacla Lactococcus lactis subsp. lactis (strain IL1403) Streptococcus lactis 7 unspecified role unspecified role prey prey lacla Lactococcus lactis subsp. lactis (strain IL1403) Streptococcus lactis association association lcia-ptnab-2 1 6 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range laclm Lactococcus lactis subsp. cremoris (strain MG1363) 8 unspecified role unspecified role prey prey laclm Lactococcus lactis subsp. cremoris (strain MG1363) 9 unspecified role unspecified role prey prey laclm Lactococcus lactis subsp. cremoris (strain MG1363) 5 unspecified role unspecified role prey prey laclm Lactococcus lactis subsp. cremoris (strain MG1363) association association