DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A dominant mutation in Snap25 causes impaired vesicle trafficking, sensorimotor gating, and ataxia in the blind-drunk mouse. A dominant mutation in Snap25 causes impaired vesicle trafficking, sensorimotor gating, and ataxia in the blind-drunk mouse. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Jeans AF., Oliver PL., Johnson R., Capogna M., Vikman J., Molnár Z., Babbs A., Partridge CJ., Salehi A., Bengtsson M., Eliasson L., Rorsman P., Davies KE. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Jeans AF., Oliver PL., Johnson R., Capogna M., Vikman J., Molnár Z., Babbs A., Partridge CJ., Salehi A., Bengtsson M., Eliasson L., Rorsman P., Davies KE. DIP original experiment: DIP-261049X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx A dominant mutation in Snap25 causes impaired vesicle trafficking, sensorimotor gating, and ataxia in the blind-drunk mouse. A dominant mutation in Snap25 causes impaired vesicle trafficking, sensorimotor gating, and ataxia in the blind-drunk mouse. A dominant mutation in Snap25 causes impaired vesicle trafficking, sensorimotor gating, and ataxia in the blind-drunk mouse. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Jeans AF., Oliver PL., Johnson R., Capogna M., Vikman J., Molnár Z., Babbs A., Partridge CJ., Salehi A., Bengtsson M., Eliasson L., Rorsman P., Davies KE. Only protein-protein interactions in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Jeans AF., Oliver PL., Johnson R., Capogna M., Vikman J., Molnár Z., Babbs A., Partridge CJ., Salehi A., Bengtsson M., Eliasson L., Rorsman P., Davies KE. DIP original experiment: DIP-261050X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx A dominant mutation in Snap25 causes impaired vesicle trafficking, sensorimotor gating, and ataxia in the blind-drunk mouse. snp25_mouse Synaptosomal-associated protein 25 Synaptosomal-associated 25 kDa protein Super protein Snap25 Snap protein protein mouse Mus musculus Mouse MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG DIP protein P60879 original sequence version: 38 DIP protein P60879-1 original sequence version: 41 DIP protein P60879-1 original sequence version: 109 DIP protein P60879-1 original sequence version: 81 DIP protein P60879 original sequence version: 111 FBED2B082A4CB6A6 stx1a_mouse Syntaxin-1A Stx1a Neuron-specific antigen HPC-1 protein protein mouse Mus musculus Mouse MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG DIP protein O35526 original sequence version: 122 DIP protein O35526 original sequence version: 124 DIP protein O35526 original sequence version: 139 8F8255F2EEF886CA vamp2_mouse Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein mouse Mus musculus Mouse MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST DIP protein P63044 original sequence version: 28 DIP protein P63044 original sequence version: 32 DIP protein P63044 original sequence version: 98 DIP protein P63044 original sequence version: 70 DIP protein P63044 original sequence version: 100 DIP protein P63044 original sequence version: 116 4A0D0D56B5409D0A snap25-stx1a-12 1 3 unspecified role unspecified role bait bait ecolx Escherichia coli 4 unspecified role unspecified role prey prey Region 1-265 Region 1-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction snap25-vamp2-1 2 3 unspecified role unspecified role bait bait ecolx Escherichia coli 5 unspecified role unspecified role prey prey Region 1-96 Region 1-96 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction