DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Substrate interactions with human ferrochelatase. Substrate interactions with human ferrochelatase. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Medlock A., Swartz L., Dailey TA., Dailey HA., Lanzilotta WN. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Medlock A., Swartz L., Dailey TA., Dailey HA., Lanzilotta WN. DIP original experiment: DIP-260995X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx Substrate interactions with human ferrochelatase. hemh_human Ferrochelatase, mitochondrial Protoheme ferro-lyase Heme synthase FECH protein protein human Homo sapiens Human MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQVQPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL DIP protein P22830 original sequence version: 155 3FD50965E8DEABCE fech-5 1 2 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction