DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Nature 2007 imex curation Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. DIP original experiment: DIP-253240X Nature 2007 IMEx Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Nature 2007 imex curation Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. DIP original experiment: DIP-253244X Nature 2007 IMEx Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Nature 2007 imex curation Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. DIP original experiment: DIP-253241X Nature 2007 IMEx Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Nature 2007 imex curation Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. DIP original experiment: DIP-253242X Nature 2007 IMEx Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Nature 2007 imex curation Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. DIP original experiment: DIP-253243X Nature 2007 IMEx Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Nature 2007 imex curation Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. DIP original experiment: DIP-253245X Nature 2007 IMEx Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Nature 2007 imex curation Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. Only protein-protein interactions rat Rattus norvegicus (Rat) Rat anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. DIP original experiment: DIP-253246X Nature 2007 IMEx Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. Nature 2007 imex curation Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Young DW., Hassan MQ., Pratap J., Galindo M., Zaidi SK., Lee SH., Yang X., Xie R., Javed A., Underwood JM., Furcinitti P., Imbalzano AN., Penman S., Nickerson JA., Montecino MA., Lian JB., Stein JL., van Wijnen AJ., Stein GS. DIP original experiment: DIP-253239X Nature 2007 IMEx Mitotic occupancy and lineage-specific transcriptional control of rRNA genes by Runx2. runx2_human Runt-related transcription factor 2 Oncogene AML-3 Polyomavirus enhancer-binding protein 2 alpha A subunit SL3-3 enhancer factor 1 alpha A subunit SL3/AKV core-binding factor alpha A subunit Osteoblast-specific transcription factor 2 Core-binding factor subunit alpha-1 Acute myeloid leukemia 3 protein RUNX2 AML3 CBFA1 OSF2 PEBP2A protein protein human Homo sapiens Human MASNSLFSTVTPCQQNFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQQQQQQQQEAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY DIP protein Q13950 original sequence version: 155 DIP protein Q13950 original sequence version: 138 DIP protein Q13950 original sequence version: 108 DIP protein Q13950 original sequence version: 157 DIP protein Q13950 original sequence version: 135 DIP protein Q13950-1 original sequence version: 135 44C4F3867D6F3EB1 runx2_mouse Runt-related transcription factor 2 Runx2 Aml3 Cbfa1 Osf2 Pebp2a Core-binding factor subunit alpha-1 Acute myeloid leukemia 3 protein Oncogene AML-3 Polyomavirus enhancer-binding protein 2 alpha A subunit SL3-3 enhancer factor 1 alpha A subunit SL3/AKV core-binding factor alpha A subunit Osteoblast-specific transcription factor 2 protein protein mouse Mus musculus Mouse MLHSPHKQPQNHKCGANFLQEDCKKALAFKWLISAGHYQPPRPTESVSALTTVHAGIFKAASSIYNRGHKFYLEKKGGTMASNSLFSAVTPCQQSFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQEAAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSSLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSASYQFPMVPGGDRSPSRMVPPCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY DIP protein Q08775 original sequence version: 136 DIP protein Q08775 original sequence version: 135 E87A4497ED19EE0E ubf1_rat Nucleolar transcription factor 1 Ubtf Tcfubf Ubf-1 Upstream-binding factor 1 protein protein rat Rattus norvegicus (Rat) Rat MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDATTKEVKDSLGKQWSQLSDKKRLKWIHKALEQRKEYEEIMRDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQTTSPASKKPSQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYKAREAALKAQSERKPGGEREDRGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQRQYKVHLDLWVKSLSPQDRAAYKEYISNKRKNMTKLRGPNPKSSRTTLQSKSESEEDDDEEDDDDDDEEEEEDDENGDSSEDGGDSSESSSEDESEDGDENEDDDDDEDDDEDDDEDEDNESEGSSSSSSSSGDSSDSDSN DIP protein P25977 original sequence version: 105 DIP protein P25977 original sequence version: 128 ubf1_mouse Nucleolar transcription factor 1 Ubtf Tcfubf Ubf1 Ubf-1 Upstream-binding factor 1 protein protein mouse Mus musculus Mouse MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDATTKEVKDSLGKQWSQLSDKKTLKWIHKALEQRKEYEEIMRDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQTTSPASKKPSQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLTEKKKAKYKAREAALKAQSERKPGGEREDRGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQRQYKVHLDLWVKSLSPQDRAAYKEYISNKRKNMTKLRGPNPKSSRTTLQSKSESEEDDDEEEEDDEEEEEEEEDDENGDSSEDGGDSSESSSEDESEDGDENDDDDDDEDDEDDDDEDEDNESEGSSSSSSSSGDSSDSGSN DIP protein P25976 original sequence version: 117 DIP protein P25976-1 original sequence version: 74 mint UBF recognizes the ribosomal RNA gene promoter and activates transcription mediated by RNA polymerase I through cooperative interactions with the species-specific factor SL1. It binds specifically to the upstream control element 006A20A7F968DB6A taf1a_mouse TATA box-binding protein-associated factor RNA polymerase I subunit A Taf1a RNA polymerase I-specific TBP-associated factor 48 kDa TATA box-binding protein-associated factor 1A Transcription initiation factor SL1/TIF-IB subunit A protein protein mouse Mus musculus Mouse MMSDFGEELTKLAVAEDNPETSVLSKTGMHFPWLHKHVEAVVTGGKKRKDFAQTTSACLSFIQEALLKHQWQQAAEYMHSYLQTLEDSDTDKRQAAPEIIWKLGSEILFYHPKSNVETFNSFADRMKNIGVLNYLKISLQHALYLLHHGMLDDANRNLSKAETWRYGEKSSSQEVLINLVQAYKGLLQYYTWTRKKMELSKLDEDDYAYAAKTRTMLSQSCKTSTNICALVKTPGVWDPFVKSYVEMLEFYGDQDGAREMLTNYAYDEKFPSNPNAHVYLYEFLKREKAPRAKLISVLKILHEIVPSHTLMLEFHTLLRKSDTEEHQKLGLSVLFEVLDFAGCNKNITAWKYLAKYLKQILVGSHHEWVEEEWKSRRNWWPAFHFSFFWAKSDWKADTDLACEKAFVAGVLLGKGCKYFRYILKQDHETLKKKIKRMKKSVKKYTIVNPGVHT DIP protein P97357 original sequence version: 82 ubf1_human Nucleolar transcription factor 1 UBTF UBF UBF1 Upstream-binding factor 1 Autoantigen NOR-90 protein protein human Homo sapiens Human MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAFKDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDATTKEVKDSLGKQWSQLSDKKRLKWIHKALEQRKEYEEIMRDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYKAREAALKAQSERKPGGEREERGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYISNKRKSMTKLRGPNPKSSRTTLQSKSESEEDDEEDEDDEDEDEEEEDDENGDSSEDGGDSSESSSEDESEDGDENEEDDEDEDDDEDDDEDEDNESEGSSSSSSSSGDSSDSDSN DIP protein P17480 original sequence version: 148 DIP protein P17480 original sequence version: 123 DIP protein P17480 original sequence version: 173 D4F0F8BB180E757D runx2_rat Runt-related transcription factor 2 Runx2 Cbfa1 Osf2 Core-binding factor subunit alpha-1 Osteoblast-specific transcription factor 2 protein protein rat Rattus norvegicus (Rat) Rat MLHSPHKQPQNHKCGANFLQEDSKEALVFKWLISAGHYQPPRPTESVSALSTVHAVIFKAASSIYNRGHKFYLEKKGGTMASNSLFSAVTPCQQSFFWNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRI DIP protein Q9Z2J9 original sequence version: 91 D6465458B60628A2 ubtf-runx2-1 3 12 unspecified role unspecified role bait bait mouse Mus musculus Mouse 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association runx2-ubtf-1 2 9 unspecified role unspecified role bait bait human Homo sapiens Human 14 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association ubtf-runx2-2 8 12 unspecified role unspecified role bait bait mouse Mus musculus Mouse 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse association association runx2-ubtf-2 4 12 unspecified role unspecified role prey prey mouse Mus musculus Mouse 10 unspecified role unspecified role bait bait mouse Mus musculus Mouse physical association physical association runx2-taf1a-1 1 12 unspecified role unspecified role prey prey mouse Mus musculus Mouse 13 unspecified role unspecified role prey prey mouse Mus musculus Mouse 10 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association ubtf-runx2-3 6 15 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 11 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat physical association physical association ubtf-runx2-4 5 9 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association runx2-ubtf-3 7 15 unspecified role unspecified role bait bait rat Rattus norvegicus (Rat) Rat 11 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat physical association physical association