DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu LIM-only protein, CRP2, switched on smooth muscle gene activity in adult cardiac myocytes. LIM-only protein, CRP2, switched on smooth muscle gene activity in adult cardiac myocytes. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Chang DF., Belaguli NS., Chang J., Schwartz RJ. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chang DF., Belaguli NS., Chang J., Schwartz RJ. DIP original experiment: DIP-260538X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx LIM-only protein, CRP2, switched on smooth muscle gene activity in adult cardiac myocytes. LIM-only protein, CRP2, switched on smooth muscle gene activity in adult cardiac myocytes. LIM-only protein, CRP2, switched on smooth muscle gene activity in adult cardiac myocytes. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Chang DF., Belaguli NS., Chang J., Schwartz RJ. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chang DF., Belaguli NS., Chang J., Schwartz RJ. DIP original experiment: DIP-260539X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx LIM-only protein, CRP2, switched on smooth muscle gene activity in adult cardiac myocytes. LIM-only protein, CRP2, switched on smooth muscle gene activity in adult cardiac myocytes. LIM-only protein, CRP2, switched on smooth muscle gene activity in adult cardiac myocytes. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Chang DF., Belaguli NS., Chang J., Schwartz RJ. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Chang DF., Belaguli NS., Chang J., Schwartz RJ. DIP original experiment: DIP-260537X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx LIM-only protein, CRP2, switched on smooth muscle gene activity in adult cardiac myocytes. LIM-only protein, CRP2, switched on smooth muscle gene activity in adult cardiac myocytes. LIM-only protein, CRP2, switched on smooth muscle gene activity in adult cardiac myocytes. Proceedings of the National Academy of Sciences of the United States of America 2007 imex curation Chang DF., Belaguli NS., Chang J., Schwartz RJ. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chang DF., Belaguli NS., Chang J., Schwartz RJ. DIP original experiment: DIP-260540X Proceedings of the National Academy of Sciences of the United States of America 2007 IMEx LIM-only protein, CRP2, switched on smooth muscle gene activity in adult cardiac myocytes. smca4_mouse Transcription activator BRG1 Smarca4 Baf190a Brg1 Snf2b Snf2l4 ATP-dependent helicase SMARCA4 BRG1-associated factor 190A Protein brahma homolog 1 SNF2-beta SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4 protein protein mouse Mus musculus Mouse MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPMPTQGPGGYPQDNMHQMHKPMESMHEKGMPDDPRYNQMKGMGMRSGAHTGMAPPPSPMDQHSQGYPSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGSDPQALGQQNRGPTPFNQNQLHQLRAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQKLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPLVPLHQKQSRITPIQKPRGLDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEVVVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFREYHRSVTGKLQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRKLIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIGPDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEESGSEEEEEEEEEEQPQPAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAARRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASGKFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLKTFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDEEEDEVPDDETVNQMIARHEEEFDLFMRMDLDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYSDSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSEAGSSTPTTSTRSRDKDEESKKQKKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGSRAKPVVSDDDSEEEQEEDRSGSGSEED DIP protein Q3TKT4 original sequence version: 82 DIP protein Q3TKT4 original sequence version: 56 DIP protein Q3TKT4 original sequence version: 43 DIP protein Q3TKT4 original sequence version: 75 C23804ED858F98FE csrp2_rat Cysteine and glycine-rich protein 2 Smooth muscle cell LIM protein Csrp2 Smlim Cysteine-rich protein 2 protein protein rat Rattus norvegicus (Rat) Rat MPVWGGGNKCGACGRTVYHAEEVQCDGRTFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESAQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ DIP protein Q62908 original sequence version: 92 D412299E95190DC3 gata4_rat Transcription factor GATA-4 Gata4 DNA-binding protein GATA-GT2 GATA-binding factor 4 protein protein rat Rattus norvegicus (Rat) Rat MYQSLAMAANHGPPPGAYEAGGPGAFMHSAGAASSPVYVPTPRVPSSVLGLSYLQGGGSGAASGATSGGSSGAGPSGAGPGTQQGSPGWSQAGAEGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYSSSGGAAGAGLAGREQYGRPGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAGPPGESLPPSSGASSNSSNATSSSSSSEEMRPIKTEPGLSSHYGHSSSMSQTFSTVSGHGSSIHPVLSALKLSPQGYPSPVTQTSQASSKQDSWNSLVLADSHGDIITA DIP protein P46152 original sequence version: 113 7C594FA95080AD43 csrp2-smarca4-1 3 5 unspecified role unspecified role prey prey mouse Mus musculus Mouse 6 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association gata4-smarca4-1 1 7 unspecified role unspecified role bait bait MBP-tag MBP-tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 5 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association smarca4-csrp2-1 4 5 unspecified role unspecified role bait bait mouse Mus musculus Mouse 6 unspecified role unspecified role prey prey V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 1-85 Region 1-85 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 35-145 Region 35-145 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse physical association physical association csrp2-smarca4-2 2 5 unspecified role unspecified role prey prey mouse Mus musculus Mouse 6 unspecified role unspecified role bait bait Region 1-85 Region 1-85 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Region 35-145 Region 35-145 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain mouse Mus musculus Mouse physical association physical association