DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu DNA damage-induced Bcl-xL deamidation is mediated by NHE-1 antiport regulated intracellular pH. DNA damage-induced Bcl-xL deamidation is mediated by NHE-1 antiport regulated intracellular pH. PLoS biology 2007 imex curation Zhao R., Oxley D., Smith TS., Follows GA., Green AR., Alexander DR. Only protein-protein interactions in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom predetermined predetermined participant predetermined Zhao R., Oxley D., Smith TS., Follows GA., Green AR., Alexander DR. DIP original experiment: DIP-66496X PLoS biology 2007 IMEx DNA damage-induced Bcl-xL deamidation is mediated by NHE-1 antiport regulated intracellular pH. DNA damage-induced Bcl-xL deamidation is mediated by NHE-1 antiport regulated intracellular pH. DNA damage-induced Bcl-xL deamidation is mediated by NHE-1 antiport regulated intracellular pH. PLoS biology 2007 imex curation Zhao R., Oxley D., Smith TS., Follows GA., Green AR., Alexander DR. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao R., Oxley D., Smith TS., Follows GA., Green AR., Alexander DR. DIP original experiment: DIP-66494X PLoS biology 2007 IMEx DNA damage-induced Bcl-xL deamidation is mediated by NHE-1 antiport regulated intracellular pH. DNA damage-induced Bcl-xL deamidation is mediated by NHE-1 antiport regulated intracellular pH. DNA damage-induced Bcl-xL deamidation is mediated by NHE-1 antiport regulated intracellular pH. PLoS biology 2007 imex curation Zhao R., Oxley D., Smith TS., Follows GA., Green AR., Alexander DR. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao R., Oxley D., Smith TS., Follows GA., Green AR., Alexander DR. DIP original experiment: DIP-66497X PLoS biology 2007 IMEx DNA damage-induced Bcl-xL deamidation is mediated by NHE-1 antiport regulated intracellular pH. DNA damage-induced Bcl-xL deamidation is mediated by NHE-1 antiport regulated intracellular pH. DNA damage-induced Bcl-xL deamidation is mediated by NHE-1 antiport regulated intracellular pH. PLoS biology 2007 imex curation Zhao R., Oxley D., Smith TS., Follows GA., Green AR., Alexander DR. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao R., Oxley D., Smith TS., Follows GA., Green AR., Alexander DR. DIP original experiment: DIP-66495X PLoS biology 2007 IMEx DNA damage-induced Bcl-xL deamidation is mediated by NHE-1 antiport regulated intracellular pH. o54918-3 Bcl-2-like protein 11 Bcl2l11 Bim Bcl2-interacting mediator of cell death protein protein mouse Mus musculus Mouse MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH DIP protein O54918-3 original sequence version: 57 67AB421AC1E4D2CA bbc3_human Bcl-2-binding component 3, isoforms 1/2 p53 up-regulated modulator of apoptosis JFY-1 BBC3 PUMA protein protein human Homo sapiens Human MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN DIP protein Q9BXH1 original sequence version: 32 3585527F1858A4FA q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE bcl2l11-bcl2l1-2 2 5 unspecified role unspecified role bait bait mouse Mus musculus Mouse 7 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association bcl2l1-bbc3-1 4 6 unspecified role unspecified role prey prey mouse Mus musculus Mouse 5 unspecified role unspecified role prey prey mouse Mus musculus Mouse 7 unspecified role unspecified role bait bait mouse Mus musculus Mouse association association bcl2l1-bcl2l11-5 1 5 unspecified role unspecified role prey prey ecolx Escherichia coli 7 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction bbc3-bcl2l1-1 3 6 unspecified role unspecified role bait bait mouse Mus musculus Mouse 7 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association