DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis of cell surface receptor recognition by botulinum neurotoxin B. Structural basis of cell surface receptor recognition by botulinum neurotoxin B. Nature 2006 imex curation Chai Q., Arndt JW., Dong M., Tepp WH., Johnson EA., Chapman ER., Stevens RC. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chai Q., Arndt JW., Dong M., Tepp WH., Johnson EA., Chapman ER., Stevens RC. DIP original experiment: DIP-254847X Nature 2006 IMEx Structural basis of cell surface receptor recognition by botulinum neurotoxin B. Structural basis of cell surface receptor recognition by botulinum neurotoxin B. Structural basis of cell surface receptor recognition by botulinum neurotoxin B. Nature 2006 imex curation Chai Q., Arndt JW., Dong M., Tepp WH., Johnson EA., Chapman ER., Stevens RC. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chai Q., Arndt JW., Dong M., Tepp WH., Johnson EA., Chapman ER., Stevens RC. DIP original experiment: DIP-254848X Nature 2006 IMEx Structural basis of cell surface receptor recognition by botulinum neurotoxin B. Structural basis of cell surface receptor recognition by botulinum neurotoxin B. Structural basis of cell surface receptor recognition by botulinum neurotoxin B. Nature 2006 imex curation Chai Q., Arndt JW., Dong M., Tepp WH., Johnson EA., Chapman ER., Stevens RC. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Chai Q., Arndt JW., Dong M., Tepp WH., Johnson EA., Chapman ER., Stevens RC. DIP original experiment: DIP-254849X Nature 2006 IMEx Structural basis of cell surface receptor recognition by botulinum neurotoxin B. syt2_mouse Synaptotagmin-2 Syt2 Inositol polyphosphate-binding protein Synaptotagmin II protein protein mouse Mus musculus Mouse MRNIFKRNQEPNVAPATTTATMPLAPVAPADNSTESTGPGESQEDMFAKLKEKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELAGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK DIP protein P46097 original sequence version: 113 DIP protein P46097 original sequence version: 117 B4BD13FF70E0481B syt1_rat Synaptotagmin-1 Syt1 Synaptotagmin I p65 protein protein rat Rattus norvegicus (Rat) Rat MVSASHPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWALIAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK DIP protein P21707 original sequence version: 71 DIP protein P21707 original sequence version: 76 DIP protein P21707 original sequence version: 141 DIP protein P21707 original sequence version: 112 DIP protein P21707 original sequence version: 145 DIP protein P21707 original sequence version: 160 06CE28F04C97A722 bxb_clobo Botulinum neurotoxin type B botB Bontoxilysin-B protein protein clobo Clostridium botulinum MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERYTFGYKPEDFNKSSGIFNRDVCEYYDPDYLNTNDKKNIFLQTMIKLFNRIKSKPLGEKLLEMIINGIPYLGDRRVPLEEFNTNIASVTVNKLISNPGEVERKKGIFANLIIFGPGPVLNENETIDIGIQNHFASREGFGGIMQMKFCPEYVSVFNNVQENKGASIFNRRGYFSDPALILMHELIHVLHGLYGIKVDDLPIVPNEKKFFMQSTDAIQAEELYTFGGQDPSIITPSTDKSIYDKVLQNFRGIVDRLNKVLVCISDPNININIYKNKFKDKYKFVEDSEGKYSIDVESFDKLYKSLMFGFTETNIAENYKIKTRASYFSDSLPPVKIKNLLDNEIYTIEEGFNISDKDMEKEYRGQNKAINKQAYEEISKEHLAVYKIQMCKSVKAPGICIDVDNEDLFFIADKNSFSDDLSKNERIEYNTQSNYIENDFPINELILDTDLISKIELPSENTESLTDFNVDVPVYEKQPAIKKIFTDENTIFQYLYSQTFPLDIRDISLTSSFDDALLFSNKVYSFFSMDYIKTANKVVEAGLFAGWVKQIVNDFVIEANKSNTMDKIADISLIVPYIGLALNVGNETAKGNFENAFEIAGASILLEFIPELLIPVVGAFLLESYIDNKNKIIKTIDNALTKRNEKWSDMYGLIVAQWLSTVNTQFYTIKEGMYKALNYQAQALEEIIKYRYNIYSEKEKSNINIDFNDINSKLNEGINQAIDNINNFINGCSVSYLMKKMIPLAVEKLLDFDNTLKKNLLNYIDENKLYLIGSAEYEKSKVNKYLKTIMPFDLSIYTNDTILIEMFNKYNSEILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQFKLTSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKNDGIQNYIHNEYTIINCMKNNSGWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNLNNAKIYINGKLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSYSEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPVGEILTRSKYNQNSKYINYRDLYIGEKFIIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFKKEEEKLFLAPISDSDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEEYKDYFCISKWYLKEVKRKPYNLKLGCNWQFIPKDEGWTE DIP protein P10844 original sequence version: 126 DIP protein P10844 original sequence version: 130 mint Botulinum toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that cleaves the '76-Gln-|-Phe-77' bond of synaptobrevin-2 921DE5C518140DBD botb-syt2-1 1 6 unspecified role unspecified role unspecified role unspecified role clobo Clostridium botulinum 4 unspecified role unspecified role unspecified role unspecified role Region 40-60 Region 40-60 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction syt1-botb-1 3 6 unspecified role unspecified role prey prey clobo Clostridium botulinum 5 unspecified role unspecified role bait bait Region 1-265 Region 1-265 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association syt2-botb-3 2 6 unspecified role unspecified role prey prey clobo Clostridium botulinum 4 unspecified role unspecified role bait bait Region 47-267 Region 47-267 sufficient to bind sufficient binding region sufficient to bind alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P46097:p.Phe47Ala F47A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F47A'. Wed May 02 16:16:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe47ala' Tue Jun 30 17:13:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe47Ala' P46097:p.Phe54Ala F54A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F54A'. Wed May 02 16:10:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe54ala' Tue Jun 30 17:20:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe54Ala' P46097:p.Phe55Ala F55A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F55A'. Wed May 02 15:39:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe55ala' Tue Jun 30 15:35:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe55Ala' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction