DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. DIP original experiment: DIP-264260X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. DIP original experiment: DIP-264256X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. DIP original experiment: DIP-264258X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. DIP original experiment: DIP-264261X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. DIP original experiment: DIP-264259X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ghil S., Choi JM., Kim SS., Lee YD., Liao Y., Birnbaumer L., Suh-Kim H. DIP original experiment: DIP-264257X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Compartmentalization of protein kinase A signaling by the heterotrimeric G protein Go. kap3_rat cAMP-dependent protein kinase type II-beta regulatory subunit Prkar2b protein protein rat Rattus norvegicus (Rat) Rat MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGAARFGHEGRTWGDAGAAAGGGTPSKGVNFAEEPMRSDSENGEEEEAAEAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVRITMKRKGKSDIEENGAVEIARCLRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA DIP protein P12369 original sequence version: 133 8BC984E325FA3612 kapca_human cAMP-dependent protein kinase catalytic subunit alpha PRKACA PKACA protein protein human Homo sapiens Human MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF DIP protein P17612 original sequence version: 171 DIP protein P17612 original sequence version: 175 DIP protein P17612 original sequence version: 178 DIP protein P17612-1 original sequence version: 177 DIP protein P17612 original sequence version: 186 DIP protein P17612 original sequence version: 102 DIP protein P17612-1 original sequence version: 102 BF6D3ECD2614E5AB kap3_human cAMP-dependent protein kinase type II-beta regulatory subunit PRKAR2B protein protein human Homo sapiens Human MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA DIP protein P31323 original sequence version: 143 83F402CCFFEFD186 kapca_rat cAMP-dependent protein kinase catalytic subunit alpha Prkaca protein protein rat Rattus norvegicus (Rat) Rat MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWEDPSQNTAQLDHFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF DIP protein P27791 original sequence version: 143 4763ACD074AB2384 gnao_rat Guanine nucleotide-binding protein G(o) subunit alpha Gnao1 Gna0 Gnao protein protein rat Rattus norvegicus (Rat) Rat MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKADSKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYPGSNTYEDAAAYIQTQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY DIP protein P59215 original sequence version: 119 DIP protein P59215 original sequence version: 86 mint Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(o) protein function is not clear homomint 577024F61B179C89 gnao1-prkaca-1 2 11 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 10 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat 7 unspecified role unspecified role prey prey rat Rattus norvegicus (Rat) Rat association association prkaca-prkar2b-6 1 8 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 9 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction prkaca-gnao1-1 3 8 unspecified role unspecified role bait bait human Homo sapiens Human 11 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association gnao1-prkaca-2 4 8 unspecified role unspecified role prey prey ecolx Escherichia coli 11 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction prkaca-gnao1-2 5 8 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 11 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction gnao1-prkaca-3 6 8 unspecified role unspecified role prey prey human Homo sapiens Human 11 unspecified role unspecified role bait bait human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human association association