DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. DIP original experiment: DIP-264171X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. DIP original experiment: DIP-264159X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. DIP original experiment: DIP-264164X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. DIP original experiment: DIP-264158X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. DIP original experiment: DIP-264167X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. DIP original experiment: DIP-264172X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. DIP original experiment: DIP-264170X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. DIP original experiment: DIP-264162X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. DIP original experiment: DIP-264169X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. Only protein-protein interactions Salmonella typhimurium Salmonella typhimurium pull down pull down western blot western blot Immuno blot Immuno blot Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. DIP original experiment: DIP-264165X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. DIP original experiment: DIP-264163X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. DIP original experiment: DIP-264168X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. DIP original experiment: DIP-264166X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. DIP original experiment: DIP-264160X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. An escort mechanism for cycling of export chaperones during flagellum assembly. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Evans LD., Stafford GP., Ahmed S., Fraser GM., Hughes C. DIP original experiment: DIP-264161X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx An escort mechanism for cycling of export chaperones during flagellum assembly. flit_salty Flagellar protein FliT fliT STM1962 protein protein salty Salmonella typhimurium MTSTVEFINRWQRIALLSQSLLELAQRGEWDLLLQQEVSYLQSIETVMEKQTPPGITRSIQDMVAGYIKQTLDNEQLLKGLLQQRLDELSSLIGQSTRQKSLNNAYGRLSGMLLVPDAPGAS DIP protein P0A1N2 original sequence version: 64 flij_salty Flagellar FliJ protein flaO flaS STM1973 fliJ protein protein salty Salmonella typhimurium MAQHGALETLKDLAEKEVDDAARLLGEMRRGCQQAEEQLKMLIDYQNEYRSNLNTDMGNGIASNRWINYQQFIQTLEKAIEQHRLQLTQWTQKVDLALKSWREKKQRLQAWQTLQDRQTAAALLAENRMDQKKMDEFAQRAAMRKPE DIP protein P0A1K1 original sequence version: 70 34451B5F4514AF08 flgk_salty Flagellar hook-associated protein 1 flgK flaS flaW STM1183 protein protein salty Salmonella typhimurium MSSLINHAMSGLNAAQAALNTVSNNINNYNVAGYTRQTTILAQANSTLGAGGWIGNGVYVSGVQREYDAFITNQLRGAQNQSSGLTTRYEQMSKIDNLLADKSSSLSGSLQSFFTSLQTLVSNAEDPAARQALIGKAEGLVNQFKTTDQYLRDQDKQVNIAIGSSVAQINNYAKQIANLNDQISRMTGVGAGASPNDLLDQRDQLVSELNKIVGVEVSVQDGGTYNLTMANGYTLVQGSTARQLAAVPSSADPTRTTVAYVDEAAGNIEIPEKLLNTGSLGGLLTFRSQDLDQTRNTLGQLALAFADAFNAQHTKGYDADGNKGKDFFSIGSPVVYSNSNNADKTVSLTAKVVDSTKVQATDYKIVFDGTDWQVTRTADNTTFTATKDADGKLEIDGLKVTVGTGAQKNDSFLLKPVSNAIVDMNVKVTNEAEIAMASESKLDPDVDTGDSDNRNGQALLDLQNSNVVGGNKTFNDAYATLVSDVGNKTSTLKTSSTTQANVVKQLYKQQQSVSGVNLDEEYGNLQRYQQYYLANAQVLQTANALFDALLNIR DIP protein P0A1J5 original sequence version: 71 flgn_salty Flagella synthesis protein FlgN flgN STM1171 protein protein salty Salmonella typhimurium MTRLSEILDQMTTVLNDLKTVMDAEQQQLSVGQINGSQLQRITEEKSSLLATLDYLEQQRRLEQNAQRSANDDIAERWQAITEKTQHLRDLNQHNGWLLEGQIERNQQALEVLKPHQEPTLYGADGQTSVSHRGGKKISI DIP protein P0A1J7 original sequence version: 59 flgl_salty Flagellar hook-associated protein 3 Hook-filament junction protein flgL flaT flaU STM1184 protein protein salty Salmonella typhimurium MRISTQMMYEQNMSGITNSQAEWMKLGEQMSTGKRVTNPSDDPIAASQAVVLSQAQAQNSQYALARTFATQKVSLEESVLSQVTTAIQTAQEKIVYAGNGTLSDDDRASLATDLQGIRDQLMNLANSTDGNGRYIFAGYKTEAAPFDQATGGYHGGEKSVTQQVDSARTMVIGHTGAQIFNSITSNAVPEPDGSDSEKNLFVMLDTAIAALKTPVEGNNVEKEKAAAAIDKTNRGLKNSLNNVLTVRAELGTQLSELSTLDSLGSDRALGQKLQMSNLVDVDWNSVISSYVMQQAALQASYKTFTDMQGMSLFQLNR DIP protein P16326 original sequence version: 98 flgk-flgn-3 1 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction flij-flgn-1 4 19 unspecified role unspecified role prey prey ecolx Escherichia coli 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction flgk-flgn-4 5 18 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction flgn-flij-1 13 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction flij-flgn-2 11 19 unspecified role unspecified role prey prey ecolx Escherichia coli 17 unspecified role unspecified role bait bait Region 21-30 Region 21-30 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 31-40 Region 31-40 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 41-50 Region 41-50 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction flij-flit-1 2 16 unspecified role unspecified role prey prey ecolx Escherichia coli 17 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction flij-flgn-3 12 19 unspecified role unspecified role prey prey Region 81-90 Region 81-90 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 91-100 Region 91-100 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 17 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction flij-flgn-4 6 16 unspecified role unspecified role prey prey ecolx Escherichia coli 19 unspecified role unspecified role prey prey ecolx Escherichia coli 17 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association flij-flit-2 3 16 unspecified role unspecified role prey prey ecolx Escherichia coli 17 unspecified role unspecified role bait bait Region 61-70 Region 61-70 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 71-80 Region 71-80 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 81-90 Region 81-90 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 91-100 Region 91-100 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction flgn-flij-2 14 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction flgk-flgn-5 9 18 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 19 unspecified role unspecified role prey prey Region 81-90 Region 81-90 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 91-100 Region 91-100 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction flij-flit-3 15 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction flij-flgn-5 10 19 unspecified role unspecified role prey prey Salmonella typhimurium Salmonella typhimurium 17 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Salmonella typhimurium Salmonella typhimurium physical association physical association flgn-flij-3 8 19 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 16 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 17 unspecified role unspecified role unspecified role unspecified role His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association flgl-flgn-2 7 20 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 19 unspecified role unspecified role prey prey Region 81-90 Region 81-90 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 91-100 Region 91-100 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction