DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264087X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions caeel Caenorhabditis elegans molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264078X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264084X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264080X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264081X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264082X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264086X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264079X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264085X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Harrison MM., Ceol CJ., Lu X., Horvitz HR. Only protein-protein interactions caeel Caenorhabditis elegans anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Harrison MM., Ceol CJ., Lu X., Horvitz HR. DIP original experiment: DIP-264083X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Some C. elegans class B synthetic multivulva proteins encode a conserved LIN-35 Rb-containing complex distinct from a NuRD-like complex. lin54_caeel Protein lin-54 lin-54 Abnormal cell lineage protein 54 JC8.6 protein protein caeel Caenorhabditis elegans MNQGEIVYQDDDDYYDESEIYDNYEEGAEFIEVNGQLVPHNPNLQAQQNRPGTSSMIQQHNRSMEVNQGLVKDEPIDTSSHRVYVPPPRPVQRKLFQPGPSTPGSSQYTVRNLSNLSGSPSMYDRQPASLPRTVQPMGLEMGNSEQRKVYIDMKDHVSHIRLKTKKKVFAPGQRKPCNCTKSQCLKLYCDCFANGEFCRDCNCKDCHNNIEYDSQRSKAIRQSLERNPNAFKPKIGIARGGITDIERLHQKGCHCKKSGCLKNYCECYEAKVPCTDRCKCKGCQNTETYRMTRYKNSGGAVSNTNALMSLTNASSTATPDSGPGSVVTDEHGDDYEDMLLSHKPKVEMDPRRFPWYYMTDEVVEAATMCMVAQAEEALNYEKVQTEDEKLINMEKLVLREFGRCLEQMITNTTELTQDLDAAPTDDIPGPSTSTS DIP protein Q95QD7 original sequence version: 84 7629A5C749D25A5D tfdp1_caeel Transcription factor dpl-1 dpl-1 T23G7.1 protein protein caeel Caenorhabditis elegans MNPTNYDPRIGQPAQSRPQVSLSMGRRIVQMPTGLPRSYQDESHNEPVGWDEPSGVGGSSGAGGQQSDKPTGLRHFSTKVCEKVKEKGLTNYNEVADELVADYFQNNLIKQIDVVKQEYDMKNIRRRVYDALNVLLAMNIITKSKKDIRWIGLPASASQEISRLEEEKSRREASISSKKQALEEMVLQIVSYKNLVERNRKNEHKNGRPENDTVLHLPFLIINTDKEANVECSVSSDKSEFLFSFDKKFEIHDDFEILKKLNLACSLETTNPTAEEVKTAKSFLPTLHQHYVDEIIANRKKVEAEKEEKRKQQQLIADQMSMNLSQAQYVEPTSSLAQMSYSSRFNRQLQEHLINDGSEDRSAAAGIMERDYDMDKNVNQGSASRGPMYNTYSPQKIRAQVNTPLQVPPVTKRYYVQKTQGPMKHDMTPVVRTVNRPYSTVPPDRRLSTGATSVNSGPVKYYVPQGHQPMHQPVGQRYRVRPQQPQMSHMGQPHQVQQRVVYPAGSISGHQLQPGQRIVTQRIVAPGGPHPPGTIVRKVIRKIVVNNPKQSPAQQVIQKKMMEQDMCTFERKTEQPMTSAQAAALIQHPQPEEYDYFQ DIP protein Q22703 original sequence version: 104 A79692087FF3D2AE lin52_caeel Protein lin-52 lin-52 Abnormal cell lineage protein 52 ZK632.13 protein protein caeel Caenorhabditis elegans MSRPLGFIGYEFGDDEMFVQQMIEKKSNAEQAKMLEQQKKMLECTETMPEESEPVPMKCLDFEEAFQSESVSKGYESPYKNISFLKEDAVTVNTMSHCPADDIAKLIRNIQNSVYTLGIEEARQCRRGKLLNVLKPTGSASPRYLQPTPPKNVAEETTGSQ DIP protein Q10120 original sequence version: 81 601BFBDED4FF68FC lin53_caeel Probable histone-binding protein lin-53 lin-53 rba-2 K07A1.12 Abnormal cell lineage protein 53 Synthetic multivulva protein p48 protein protein caeel Caenorhabditis elegans MATLEDGTSEDRVANDEYKIWKKNTPFLYDLVMTHALEWPSLSVQWLPDVAKDNSDHTIHRLILGTHTSDEQNHLLISKICMPTDDAQFDASRYDTERSEYGGFGAVNGKVEPDIRINHEGEVNRARYMPQKSNIIATKSPHADVYIFDYLKHSAVPRDNTFNPLIRLKGHTKEGYGLSWNPNKEGLILSASDDQTVCHWDINANQNVAGELQAKDVFKGHESVVEDVAWHVLHDGVFGSVGDDKKLLIWDVRTSTPGHCIDAHSAEVNCLAFNPYSEFILATGSADKTVALWDLRNLRMKLHSFESHRDEIFQVQWSPHNETILASSGTDKRLHVWDLSKIGEDQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVVCSVSEDNILQVWQMADNIYNEVDEETPADVVERQQ DIP protein P90916 original sequence version: 106 AE388CFB048CE51B lin8_caeel Protein lin-8 lin-8 Abnormal cell lineage protein 8 B0454.1 protein protein caeel Caenorhabditis elegans MSKIKTHSTGSKRTVPFYKLPPPVPLPPLPPPDPTRYFSTEKYIALSKDEKFKFDDYDVNDETLKKVVLNEIGKCPDIWSSRSQAAIMEHYPIVATETYRRTGLLLSIKSLKQIYKCGKDNLRNRLRVAIVSKRLTPAQVEAYMWRWEFYGFIRYYRDYTQRWEADLLKDLDVVLGLEARRASKNMEKVDSGELMEPMEPMDSTMDEMCVEEEPYEETGSNWSDPAPEPSQSKSQSPEAKYPQAYLLPEADEVYNPDDFYQEEHESASNAMYRIAFSQQYGGGGSPAVQKPVTFSAQPAPAPVREAPSPVVENVSSSSFTPKPPAMINNFGEEMNQITYQAIRIAREQPERLKLLRKALFDVVLAFDQKEYADVGDLYRDLAQKNS DIP protein G5EDW7 original sequence version: 25 753922A5B6246FD9 lin9_caeel Protein lin-9 lin-9 Abnormal cell lineage protein 9 ZK637.7 protein protein caeel Caenorhabditis elegans MSSAVRSPRKKAASDTSDPDRTSSPYSLRETSKVPSRYRNEELYLSPSRSIKRTGSPKKSPAKRLNGGRDSPSVNSLTRNSSLTMLAKAALDYESSSCALEYIFQPKEERRPPRRALALSPPPAPSNDLLAKDLEMIEMHQNLVAGLDDLDNPANMTNEAVEHRDTQSFFNMFSTDQERSAMMKQFKTYKNQTSEDVSTFMRANIKKLYNLLRYKKARQWVMCEFFYSAIDEQIFKEENEFATIIRESFPNLKNWNLTRIEWRSIRKLLGKPRRCSKVFFEEERMYLEEKRMKIRSVYEGSYLNDPSIDLKDLPAKLPRPMVVGNRVFARIRNPYDGIYSGIIDAVIPKGFRIIFDKPDIPPTLVSDTEILLDGKLDLLSIAYFIEQANSKLPSGVRPFVAAVRDSSHPHLVRDVLVSRKIERSGGPLMGPNDERLNGKNAEMVGNFPLKFLVNLVKLTKLIDIKKGLIRQLNELNADAEIQNMTSDKYSKAFQEKYAKTIIDLEHVNQNIDINMNGIQDHHMYFSSNDISTSNMKPEAVRQMCSQQAGRFVEHCNQGLNVENVHALTLIQSLTAVLLQVRTMGTQKISAVDLQSLGDAISEIRTAIHPRNVAFFQDYVEVHMKQFHTIMLESGALAGTVSNRK DIP protein P30630 original sequence version: 99 C224EB2AE6FEAF92 lin35_caeel Retinoblastoma-like protein homolog lin-35 lin-35 Abnormal cell lineage protein 35 Synthetic multivulva protein lin-35 C32F10.2 protein protein caeel Caenorhabditis elegans MPKRAADEPGTSTTDPFHEQSPFDAVLAGTETTDTICEEPPAKRIDLDIKQEFNGGVQSGGLIKNESELTQMTIKQETEGNINEARREEEDEEQDEDSRTSMPPALGEDDDYEEDDADSFIDKTNTPPPSQSFLEGCRAANLPNDIVTGAWETYNHAVQRVSLEGSESAWQLSAIYYYLLSKGIKRRGKTIRILIQPFPVSILTIANSFDISVAEMLDKTARFVEIIHSRKIRRYQEYIRRIQEGLAVSCVIFKKFCRIFCKIFEEIKVGSENCPSSHELFTVLWTSFLVMKSRMTVDDLISNYQLLFSILDQVYTEMCSMKEGIVHHLNQKFVEDLLENDCTIIRALCTQFGGSVLDARHFSDHTFKKMEKTGIPSTWNFQEFRDLIMNVPKTAYENYLLQRGSIDERIFIPSVEDFSKIFQSPDTYSVADILKVSYSGRRFRDAEFLTKISNNHCLEKLALGGKVASEKLVTQSKEQPRVPCVEYNLELGNYPDDLESNNQSLYNRLTKIIGSWKLENSKLEEVCGTMSDSPMATILLKSDEMTNKFERTLSAELGETINENIPKYHYNVRKELELVFLIFMEKIIVAELKKKVREEDLLNVIRREEFLDSVFCFCVELILVSNGYDRPFPWSAELCGVHPFMFHKVIDLMITHEKQLSRQMVQHFSRIEETVIEYFSWKSDSPLWPMVVRCPFAHFQEFGEDWADKLNSYSPIKFTPIKKPDDLRDELGRPIVPQNQTSRTLRIFLKRTYFTAARRLQDLTDRVSMGARAKSQCWSLFDYLLRNDTLIFMDRHLDQILLCCVFVIMKINESSMLFTEIMAQYRRQSANSLLVYRSVTVFQEQLNPENPQAVNTKETILERLEGPQKEKTTVDIIKYYNIEFRDRIKYIIGQIDSASDEDLMEMPVATESGLMPVRVYLTHKLSIQTLPKTKHGESKQERAIANLEKSGITIAMERSGD DIP protein G5EDT1 original sequence version: 31 712475505E527DF1 q23482_caeel lin-37 ZK418.4 CELE_ZK418.4 protein protein caeel Caenorhabditis elegans MSEIDPLAEFLLPEDGDRNARQNDPLISGGPLPLESPSRKLTSLLSYDPTVPESPDMKFARKRLGNLLTTIKHHPSEIIGVLPEDYTRADEEPGRQGRPPGRPRKMPRHESSTSLMESPRKTMTRDSKIMFELRGKPFEMIAGRFEEEYSLGRAWVKGHMNNEYEPIKAQRTDYAPNLAVDYLACREIHRMPRPDKSIPELPIVPSRIDEFDATVDPRYETDLKNEYIRHWKQVKKGWCAHQRRRTAPHARSIALINKIYQPGESKTVEQALGLI DIP protein Q23482 original sequence version: 83 0FE64938F5A6107D lin_37-lin_54-1 2 11 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans 18 unspecified role unspecified role unspecified role unspecified role caeel Caenorhabditis elegans physical association physical association lin_9-lin_35-1 1 11 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 18 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 17 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 13 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 16 unspecified role unspecified role bait bait caeel Caenorhabditis elegans association association lin_37-lin_52-1 3 11 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 18 unspecified role unspecified role bait bait caeel Caenorhabditis elegans 14 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 13 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 16 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association lin_9-lin_35-2 5 11 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 18 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 17 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 14 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 13 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 16 unspecified role unspecified role bait bait caeel Caenorhabditis elegans association association lin_52-lin_35-1 6 11 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 18 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 17 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 14 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 13 unspecified role unspecified role bait bait caeel Caenorhabditis elegans 16 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association lin_37-dpl_1-1 8 11 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 15 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 18 unspecified role unspecified role bait bait caeel Caenorhabditis elegans 17 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 14 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 13 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 12 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 16 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association lin_54-lin_35-1 10 11 unspecified role unspecified role bait bait caeel Caenorhabditis elegans 18 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 17 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 14 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 13 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 16 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association lin_37-lin_35-1 4 11 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 18 unspecified role unspecified role bait bait caeel Caenorhabditis elegans 17 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 14 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 13 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 16 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association lin_52-lin_35-2 9 11 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 17 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 14 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 13 unspecified role unspecified role bait bait caeel Caenorhabditis elegans 16 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association lin_37-lin_35-2 7 11 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 18 unspecified role unspecified role bait bait caeel Caenorhabditis elegans 17 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 13 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 16 unspecified role unspecified role prey prey caeel Caenorhabditis elegans association association