DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Solution structures of the adhesion molecule DdCAD-1 reveal new insights into Ca(2+)-dependent cell-cell adhesion. Solution structures of the adhesion molecule DdCAD-1 reveal new insights into Ca(2+)-dependent cell-cell adhesion. Nature structural & molecular biology 2006 imex curation Lin Z., Sriskanthadevan S., Huang H., Siu CH., Yang D. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Lin Z., Sriskanthadevan S., Huang H., Siu CH., Yang D. DIP original experiment: DIP-66576X Nature structural & molecular biology 2006 IMEx Solution structures of the adhesion molecule DdCAD-1 reveal new insights into Ca(2+)-dependent cell-cell adhesion. Solution structures of the adhesion molecule DdCAD-1 reveal new insights into Ca(2+)-dependent cell-cell adhesion. Solution structures of the adhesion molecule DdCAD-1 reveal new insights into Ca(2+)-dependent cell-cell adhesion. Nature structural & molecular biology 2006 imex curation Lin Z., Sriskanthadevan S., Huang H., Siu CH., Yang D. Only protein-protein interactions ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Lin Z., Sriskanthadevan S., Huang H., Siu CH., Yang D. DIP original experiment: DIP-66575X Nature structural & molecular biology 2006 IMEx Solution structures of the adhesion molecule DdCAD-1 reveal new insights into Ca(2+)-dependent cell-cell adhesion. cad1_dicdi Calcium-dependent cell adhesion molecule 1 cadA cad1 GP24 DDB_G0285793 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MSVDANKVKFFFGKNCTGESFEYNKGETVRFNNGDKWNDKFMSCLVGSNVRCNIWEHNEIDTPTPGKFQELAQGSTNNDLTSINGLSKFQVLPGAFQWAVDVKIVNKVNSTAGSYEMTITPYQVDKVACKDGDDFVQLPIPKLTPPDSEIVSHLTVRQTHTPYDYVVNGSVYFKYSPTTGQVTVIKKDETFPKNMTVTQDDNTSFIFNLNSEK DIP protein P54657 original sequence version: 26 mint FEE35BA62236293C cada-3 2 3 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction cada-2 1 3 unspecified role unspecified role neutral component neutral component 2-93 binding region 2-93 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain P54657:p.Lys36Glu K36E mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K36E mutation'. Wed May 02 17:54:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys36glu' Tue Jun 30 15:41:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys36Glu' P54657:p.Lys40Glu K40E mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K E This feature has been corrected as a result of our quality control procedures. The original label was 'K40E mutation'. Wed May 02 18:25:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys40glu' Tue Jun 30 16:26:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys40Glu' ecolx Escherichia coli direct interaction direct interaction