DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer. Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer. Nature structural & molecular biology 2006 imex curation Pioletti M., Findeisen F., Hura GL., Minor DL. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pioletti M., Findeisen F., Hura GL., Minor DL. DIP original experiment: DIP-66570X Nature structural & molecular biology 2006 IMEx Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer. Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer. Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer. Nature structural & molecular biology 2006 imex curation Pioletti M., Findeisen F., Hura GL., Minor DL. Only protein-protein interactions ecolx Escherichia coli saxs x ray scattering saxs predetermined predetermined participant predetermined Pioletti M., Findeisen F., Hura GL., Minor DL. DIP original experiment: DIP-66571X Nature structural & molecular biology 2006 IMEx Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer. Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer. Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer. Nature structural & molecular biology 2006 imex curation Pioletti M., Findeisen F., Hura GL., Minor DL. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Pioletti M., Findeisen F., Hura GL., Minor DL. DIP original experiment: DIP-66572X Nature structural & molecular biology 2006 IMEx Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer. kcip1_human Kv channel-interacting protein 1 KCNIP1 KCHIP1 VABP A-type potassium channel modulatory protein 1 Potassium channel-interacting protein 1 Vesicle APC-binding protein protein protein human Homo sapiens Human MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM DIP protein Q9NZI2 original sequence version: 48 D39DD5F8EA13B0FD kcnd3_rat Potassium voltage-gated channel subfamily D member 3 Kcnd3 Voltage-gated potassium channel subunit Kv4.3 protein protein rat Rattus norvegicus (Rat) Rat MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLERYPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAFYGILPEIIGDCCYEEYKDRKRENAERLMDDNESENNQESMPSLSFRQTMWRAFENPHTSTLALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVEYLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRRAQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLLHCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHSGLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSITSNVVKVSVL DIP protein Q62897 original sequence version: 58 mint Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits 26BC512BDE069C09 kcnd3-kcnip1-2 3 5 unspecified role unspecified role bait bait 1-143 binding region 1-143 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role prey prey 37-216 binding region 37-216 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain Q9NZI2:p.[Asp146Ala;Asp194Ala] D135A, D183A mutation mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D A Wed May 02 20:12:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp146ala,asp194ala' Tue Jun 30 16:22:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp146Ala;Asp194Ala]' ecolx Escherichia coli direct interaction direct interaction kcnd3-kcnip1-3 1 5 unspecified role unspecified role neutral component neutral component 1-143 binding region 1-143 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role neutral component neutral component 37-216 binding region 37-216 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction kcnd3-kcnip1-4 2 5 unspecified role unspecified role neutral component neutral component 1-143 binding region 1-143 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role neutral component neutral component 37-216 binding region 37-216 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction