DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263975X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263972X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263971X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263976X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263968X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263967X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263974X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263978X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263977X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263970X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263969X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shiba T., Koga H., Shin HW., Kawasaki M., Kato R., Nakayama K., Wakatsuki S. DIP original experiment: DIP-263973X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1. o75154-1 Rab11 family-interacting protein 3 RAB11FIP3 ARFO1 KIAA0665 Arfophilin-1 EF hands-containing Rab-interacting protein MU-MB-17.148 protein protein human Homo sapiens Human MASAPPASPPGSEPPGPDPEPGGPDGPGAAQLAPGPAELRLGAPVGGPDPQSPGLDEPAPGAAADGGARWSAGPAPGLEGGPRDPGPSAPPPRSGPRGQLASPDAPGPGPRSEAPLPELDPLFSWTEEPEECGPASCPESAPFRLQGSSSSHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQEDGPRLRAVFDALDGDGDGFVRIEDFIQFATVYGAEQVKDLTKYLDPSGLGVISFEDFYQGITAIRNGDPDGQCYGGVASAQDEEPLACPDEFDDFVTYEANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDADSAGGSAVPSECLDAMEEPDHGALLLLPGRPHPHGQSVITVIGGEEHFEDYGEGSEAELSPETLCNGQLGCSDPAFLTPSPTKRLSSKKVARYLHQSGALTMEALEDPSPELMEGPEEDIADKVVFLERRVLELEKDTAATGEQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIEIENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRMGDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLKLEAEQRRGRSSSMGLQEYHSRARESELEQEVRRLKQDNRNLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEVK DIP protein O75154-1 original sequence version: 130 DIP protein O75154-1 original sequence version: 135 DIP protein O75154-1 original sequence version: 138 rb11a_human Ras-related protein Rab-11A YL8 RAB11A RAB11 protein protein human Homo sapiens Human MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI DIP protein P62491 original sequence version: 38 DIP protein P62491-1 original sequence version: 132 DIP protein P62491 original sequence version: 122 DIP protein P62491 original sequence version: 89 DIP protein P62491-1 original sequence version: 137 DIP protein P62491 original sequence version: 136 DIP protein P62491 original sequence version: 137 DIP protein P62491-1 original sequence version: 140 76FC1E113A29B269 arf5_human ADP-ribosylation factor 5 ARF5 protein protein human Homo sapiens Human MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR DIP protein P84085 original sequence version: 115 25EF3D4895408147 arf6_human ADP-ribosylation factor 6 ARF6 protein protein human Homo sapiens Human MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS DIP protein P62330 original sequence version: 126 DIP protein P62330 original sequence version: 113 DIP protein P62330 original sequence version: 105 49E38E59AEA52B98 q86ys3-1 Rab11 family-interacting protein 4 RAB11FIP4 ARFO2 KIAA1821 Arfophilin-2 protein protein human Homo sapiens Human MAGGAGWSGAPAALLRSVRRLREVFEVCGRDPDGFLRVERVAALGLRFGQGEEVEKLVKYLDPNDLGRINFKDFCRGVFAMKGCEELLKDVLSVESAGTLPCAPEIPDCVEQGSEVTGPTFADGELIPREPGFFPEDEEEAMTLAPPEGPQELYTDSPMESTQSLEGSVGSPAEKDGGLGGLFLPEDKSLVHTPSMTTSDLSTHSTTSLISNEEQFEDYGEGDDVDCAPSSPCPDDETRTNVYSDLGSSVSSSAGQTPRKMRHVYNSELLDVYCSQCCKKINLLNDLEARLKNLKANSPNRKISSTAFGRQLMHSSNFSSSNGSTEDLFRDSIDSCDNDITEKVSFLEKKVTELENDSLTNGDLKSKLKQENTQLVHRVHELEEMVKDQETTAEQALEEEARRHREAYGKLEREKATEVELLNARVQQLEEENTELRTTVTRLKSQTEKLDEERQRMSDRLEDTSLRLKDEMDLYKRMMDKLRQNRLEFQKEREATQELIEDLRKELEHLQMYKLDCERPGRGRSASSGLGEFNARAREVELEHEVKRLKQENYKLRDQNDDLNGQILSLSLYEAKNLFAAQTKAQSLAAEIDTASRDELMEALKEQEEINFRLRQYMDKIILAILDHNPSILEIKH DIP protein Q86YS3-1 original sequence version: 103 rab11fip3-rab11a-1 11 14 unspecified role unspecified role prey prey P62491:p.Gln70Leu Q70L mutation mutation certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q70L'. Wed May 02 15:09:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln70leu' Tue Jun 30 16:54:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln70Leu' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role bait bait Region 733-756 Region 733-756 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O75154-1:p.Tyr737Ser Y737S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Y S This feature has been corrected as a result of our quality control procedures. The original label was 'Y737S'. Wed May 02 19:25:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr737ser' Tue Jun 30 17:52:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr737Ser' O75154-1:p.Asp739Ala D739A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D739A'. Wed May 02 15:15:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp739ala' Tue Jun 30 18:22:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp739Ala' O75154-1:p.Met746Ser M746S mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain M S This feature has been corrected as a result of our quality control procedures. The original label was 'M746S'. Wed May 02 14:39:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met746ser' Tue Jun 30 16:02:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met746Ser' O75154-1:p.Glu747Ala E747A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E747A'. Wed May 02 18:13:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu747ala' Tue Jun 30 17:38:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu747Ala' ecolx Escherichia coli physical association physical association rab11fip4-arf5-1 2 15 unspecified role unspecified role prey prey P84085:p.Gln71Leu Q71L mutation mutation certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q71L'. Wed May 02 15:34:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln71leu' Tue Jun 30 18:16:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln71Leu' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 17 unspecified role unspecified role bait bait Region 484-588 Region 484-588 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association rab11a-rab11fip3-1 6 13 unspecified role unspecified role prey prey Region 607-756 Region 607-756 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role bait bait P62491:p.Gln70Leu Q70L mutation mutation certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q70L'. Wed May 02 20:26:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln70leu' Tue Jun 30 18:25:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln70Leu' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rab11a-rab11fip3-2 9 13 unspecified role unspecified role prey prey T7-tag T7-tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 14 unspecified role unspecified role bait bait P62491:p.Gln70Leu Q70L mutation mutation certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q70L'. Wed May 02 18:19:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln70leu' Tue Jun 30 15:35:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln70Leu' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction rab11fip4-arf6-2 7 16 unspecified role unspecified role prey prey P62330:p.Gln67Leu Q67L mutation mutation certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q67L'. Wed May 02 19:24:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln67leu' Tue Jun 30 16:29:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln67Leu' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 17 unspecified role unspecified role bait bait Region 484-637 Region 484-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association rab11a-arf5-1 1 15 unspecified role unspecified role prey prey P84085:p.Gln71Leu Q71L mutation mutation certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q71L'. Wed May 02 19:39:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln71leu' Tue Jun 30 19:36:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln71Leu' T7-tag T7-tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 13 unspecified role unspecified role prey prey T7-tag T7-tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 14 unspecified role unspecified role bait bait P62491:p.Gln70Leu Q70L mutation mutation certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q70L'. Wed May 02 18:48:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln70leu' Tue Jun 30 17:21:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln70Leu' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli association association rab11a-rab11fip3-3 8 13 unspecified role unspecified role unspecified role unspecified role Region 607-756 Region 607-756 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 1-173 Region 1-173 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P62491:p.Gln70Leu Q70L mutation mutation certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q70L'. Wed May 02 17:07:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln70leu' Tue Jun 30 17:15:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln70Leu' ecolx Escherichia coli direct interaction direct interaction rab11a-rab11fip4-1 5 17 unspecified role unspecified role prey prey Region 484-637 Region 484-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role bait bait P62491:p.Gln70Leu Q70L mutation mutation certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q70L'. Wed May 02 16:22:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln70leu' Tue Jun 30 20:17:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln70Leu' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rab11fip3-arf5-1 3 15 unspecified role unspecified role prey prey P84085:p.Gln71Leu Q71L mutation mutation certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q71L'. Wed May 02 16:23:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln71leu' Tue Jun 30 19:24:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln71Leu' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 607-712 Region 607-712 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association rab11a-rab11fip3-4 4 13 unspecified role unspecified role unspecified role unspecified role Region 607-756 Region 607-756 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 14 unspecified role unspecified role unspecified role unspecified role Region 1-173 Region 1-173 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P62491:p.Gln70Leu Q70L mutation mutation certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q70L'. Wed May 02 17:00:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln70leu' Tue Jun 30 19:41:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln70Leu' ecolx Escherichia coli direct interaction direct interaction rab11fip4-rab11a-1 10 14 unspecified role unspecified role prey prey P62491:p.Gln70Leu Q70L mutation mutation certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q70L'. Wed May 02 16:14:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln70leu' Tue Jun 30 16:21:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln70Leu' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 17 unspecified role unspecified role bait bait Region 613-637 Region 613-637 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association rab11fip3-arf6-1 12 16 unspecified role unspecified role prey prey P62330:p.Gln67Leu Q67L mutation mutation certain certain sequence position certain certain certain sequence position certain Q L This feature has been corrected as a result of our quality control procedures. The original label was 'Q67L'. Wed May 02 19:59:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln67leu' Tue Jun 30 18:30:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln67Leu' HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 13 unspecified role unspecified role bait bait Region 607-756 Region 607-756 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association