DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. DIP original experiment: DIP-263959X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. DIP original experiment: DIP-263952X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip fingerprinting peptide massfingerprinting fingerprinting Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. DIP original experiment: DIP-263950X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip fingerprinting peptide massfingerprinting fingerprinting Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. DIP original experiment: DIP-263957X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. DIP original experiment: DIP-263953X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. DIP original experiment: DIP-263954X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. DIP original experiment: DIP-263951X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. DIP original experiment: DIP-263958X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. DIP original experiment: DIP-263960X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. DIP original experiment: DIP-263955X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Baba M., Hong SB., Sharma N., Warren MB., Nickerson ML., Iwamatsu A., Esposito D., Gillette WK., Hopkins RF., Hartley JL., Furihata M., Oishi S., Zhen W., Burke TR., Linehan WM., Schmidt LS., Zbar B. DIP original experiment: DIP-263956X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling. q8nfg4-1 Folliculin FLCN BHD BHD skin lesion fibrofolliculoma protein Birt-Hogg-Dube syndrome protein protein protein human Homo sapiens Human MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGDGNEDSPGQGEQAEEEEGGIQMNSRMRAHSPAEGASVESSSPGPKKSDMCEGCRSLAAGHPGYISHDKETSIKYVSHQHPSHPQLFSIVRQACVRSLSCEVCPGREGPIFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIITIMMDRIYLINSWPFLLGKVRGIIDELQGKALKVFEAEQFGCPQRAQRMNTAFTPFLHQRNGNAARSLTSLTSDDNLWACLHTSFAWLLKACGSRLTEKLLEGAPTEDTLVQMEKLADLEEESESWDNSEAEEEEKAPVLPESTEGRELTQGPAESSSLSGCGSWQPRKLPVFKSLRHMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGLSPHVQIPPHVLSSEFAVIVEVHAAARSTLHPVGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAALTNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKTYKSHLMSTVRSPTASESRN DIP protein Q8NFG4-1 original sequence version: 104 flcn_human Folliculin FLCN BHD BHD skin lesion fibrofolliculoma protein Birt-Hogg-Dube syndrome protein protein protein human Homo sapiens Human MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGDGNEDSPGQGEQAEEEEGGIQMNSRMRAHSPAEGASVESSSPGPKKSDMCEGCRSLAAGHPGYISHDKETSIKYVSHQHPSHPQLFSIVRQACVRSLSCEVCPGREGPIFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIITIMMDRIYLINSWPFLLGKVRGIIDELQGKALKVFEAEQFGCPQRAQRMNTAFTPFLHQRNGNAARSLTSLTSDDNLWACLHTSFAWLLKACGSRLTEKLLEGAPTEDTLVQMEKLADLEEESESWDNSEAEEEEKAPVLPESTEGRELTQGPAESSSLSGCGSWQPRKLPVFKSLRHMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGLSPHVQIPPHVLSSEFAVIVEVHAAARSTLHPVGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAALTNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKTYKSHLMSTVRSPTASESRN DIP protein Q8NFG4 original sequence version: 104 E168EB34544C6336 q8tf40-1 Folliculin-interacting protein 1 FNIP1 KIAA1961 protein protein human Homo sapiens Human MAPTLFQKLFSKRTGLGAPGRDARDPDCGFSWPLPEFDPSQIRLIVYQDCERRGRNVLFDSSVKRRNEDISVSKLGSDAQVKVFGKCCQLKPGGDSSSSLDSSVTSSSDIKDQCLKYQGSRCSSDANMLGEMMFGSVAMSYKGSTLKIHQIRSPPQLMLSKVFTARTGSSICGSLNTLQDSLEFINQDNNTLKADNNTVINGLLGNIGLSQFCSPRRAFSEQGPLRLIRSASFFAVHSNPMDMPGRELNEDRDSGIARSASLSSLLITPFPSPNSSLTRSCASSYQRRWRRSQTTSLENGVFPRWSIEESFNLSDESCGPNPGIVRKKKIAIGVIFSLSKDEDENNKFNEFFFSHFPLFESHMNKLKSAIEQAMKMSRRSADASQRSLAYNRIVDALNEFRTTICNLYTMPRIGEPVWLTMMSGTPEKNHLCYRFMKEFTFLMENASKNQFLPALITAVLTNHLAWVPTVMPNGQPPIKIFLEKHSSQSVDMLAKTHPYNPLWAQLGDLYGAIGSPVRLARTVVVGKRQDMVQRLLYFLTYFIRCSELQETHLLENGEDEAIVMPGTVITTTLEKGEIEESEYVLVTMHRNKSSLLFKESEEIRTPNCNCKYCSHPLLGQNVENISQQEREDIQNSSKELLGISDECQMISPSDCQEENAVDVKQYRDKLRTCFDAKLETVVCTGSVPVDKCALSESGLESTEETWQSEKLLDSDSHTGKAMRSTGMVVEKKPPDKIVPASFSCEAAQTKVTFLIGDSMSPDSDTELRSQAVVDQITRHHTKPLKEERGAIDQHQETKQTTKDQSGESDTQNMVSEEPCELPCWNHSDPESMSLFDEYFNDDSIETRTIDDVPFKTSTDSKDHCCMLEFSKILCTKNNKQNNEFCKCIETVPQDSCKTCFPQQDQRDTLSILVPHGDKESSDKKIAVGTEWDIPRNESSDSALGDSESEDTGHDMTRQVSSYYGGEQEDWAEEDEIPFPGSKLIEVSAVQPNIANFGRSLLGGYCSSYVPDFVLQGIGSDERFRQCLMSDLSHAVQHPVLDEPIAEAVCIIADMDKWTVQVASSQRRVTDNKLGKEVLVSSLVSNLLHSTLQLYKHNLSPNFCVMHLEDRLQELYFKSKMLSEYLRGQMRVHVKELGVVLGIESSDLPLLAAVASTHSPYVAQILL DIP protein Q8TF40-1 original sequence version: 73 aakg1_human 5'-AMP-activated protein kinase subunit gamma-1 PRKAG1 protein protein human Homo sapiens Human METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP DIP protein P54619 original sequence version: 136 DIP protein P54619 original sequence version: 138 0F22B9CA1DBD87AE fnip1_human Folliculin-interacting protein 1 FNIP1 KIAA1961 protein protein human Homo sapiens Human MAPTLFQKLFSKRTGLGAPGRDARDPDCGFSWPLPEFDPSQIRLIVYQDCERRGRNVLFDSSVKRRNEDISVSKLGSDAQVKVFGKCCQLKPGGDSSSSLDSSVTSSSDIKDQCLKYQGSRCSSDANMLGEMMFGSVAMSYKGSTLKIHQIRSPPQLMLSKVFTARTGSSICGSLNTLQDSLEFINQDNNTLKADNNTVINGLLGNIGLSQFCSPRRAFSEQGPLRLIRSASFFAVHSNPMDMPGRELNEDRDSGIARSASLSSLLITPFPSPNSSLTRSCASSYQRRWRRSQTTSLENGVFPRWSIEESFNLSDESCGPNPGIVRKKKIAIGVIFSLSKDEDENNKFNEFFFSHFPLFESHMNKLKSAIEQAMKMSRRSADASQRSLAYNRIVDALNEFRTTICNLYTMPRIGEPVWLTMMSGTPEKNHLCYRFMKEFTFLMENASKNQFLPALITAVLTNHLAWVPTVMPNGQPPIKIFLEKHSSQSVDMLAKTHPYNPLWAQLGDLYGAIGSPVRLARTVVVGKRQDMVQRLLYFLTYFIRCSELQETHLLENGEDEAIVMPGTVITTTLEKGEIEESEYVLVTMHRNKSSLLFKESEEIRTPNCNCKYCSHPLLGQNVENISQQEREDIQNSSKELLGISDECQMISPSDCQEENAVDVKQYRDKLRTCFDAKLETVVCTGSVPVDKCALSESGLESTEETWQSEKLLDSDSHTGKAMRSTGMVVEKKPPDKIVPASFSCEAAQTKVTFLIGDSMSPDSDTELRSQAVVDQITRHHTKPLKEERGAIDQHQETKQTTKDQSGESDTQNMVSEEPCELPCWNHSDPESMSLFDEYFNDDSIETRTIDDVPFKTSTDSKDHCCMLEFSKILCTKNNKQNNEFCKCIETVPQDSCKTCFPQQDQRDTLSILVPHGDKESSDKKIAVGTEWDIPRNESSDSALGDSESEDTGHDMTRQVSSYYGGEQEDWAEEDEIPFPGSKLIEVSAVQPNIANFGRSLLGGYCSSYVPDFVLQGIGSDERFRQCLMSDLSHAVQHPVLDEPIAEAVCIIADMDKWTVQVASSQRRVTDNKLGKEVLVSSLVSNLLHSTLQLYKHNLSPNFCVMHLEDRLQELYFKSKMLSEYLRGQMRVHVKELGVVLGIESSDLPLLAAVASTHSPYVAQILL DIP protein Q8TF40 original sequence version: 73 3B99DBA98E7169C5 flcn-fnip1-2 3 16 unspecified role unspecified role prey prey human Homo sapiens Human 12 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association fnip1-flcn-2 2 14 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 12 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association fnip1-flcn-3 4 15 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 12 unspecified role unspecified role prey prey human Homo sapiens Human association association flcn-fnip1-3 10 12 unspecified role unspecified role bait bait Region 345-579 Region 345-579 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 14 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction fnip1-flcn-4 9 12 unspecified role unspecified role prey prey Region 345-579 Region 345-579 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 14 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association flcn-fnip1-4 7 14 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 12 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human physical association physical association flcn-fnip1-5 5 16 unspecified role unspecified role prey prey human Homo sapiens Human 13 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association fnip1-flcn-5 8 13 unspecified role unspecified role prey prey human Homo sapiens Human 15 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human association association flcn-fnip1-6 1 12 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human 15 unspecified role unspecified role prey prey human Homo sapiens Human 14 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human Homo sapiens Human association association fnip1-flcn-6 6 16 unspecified role unspecified role bait bait human Homo sapiens Human 13 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association fnip1-flcn-7 11 12 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 14 unspecified role unspecified role bait bait Region 300-1166 Region 300-1166 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction