DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro hydroxylase assay hydroxylase assay predetermined predetermined participant predetermined Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263920X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro hydroxylase assay hydroxylase assay predetermined predetermined participant predetermined Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263923X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263897X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro decarboxxylation assay decarboxylation assay decarboxxylation assay predetermined predetermined participant predetermined Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263911X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263905X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro hydroxylase assay hydroxylase assay predetermined predetermined participant predetermined Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263924X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro hydroxylase assay hydroxylase assay predetermined predetermined participant predetermined Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263912X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263901X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263898X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263899X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263903X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro hydroxylase assay hydroxylase assay predetermined predetermined participant predetermined Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263913X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263902X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip autoradiography autoradiography Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263900X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro hydroxylase assay hydroxylase assay predetermined predetermined participant predetermined Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263915X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro hydroxylase assay hydroxylase assay predetermined predetermined participant predetermined Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263919X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip autoradiography autoradiography Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263907X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263904X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro hydroxylase assay hydroxylase assay predetermined predetermined participant predetermined Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263909X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro decarboxxylation assay decarboxylation assay decarboxxylation assay predetermined predetermined participant predetermined Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263910X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro hydroxylase assay hydroxylase assay predetermined predetermined participant predetermined Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263921X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro hydroxylase assay hydroxylase assay predetermined predetermined participant predetermined Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263916X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro hydroxylase assay hydroxylase assay predetermined predetermined participant predetermined Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263917X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro hydroxylase assay hydroxylase assay predetermined predetermined participant predetermined Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263918X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro hydroxylase assay hydroxylase assay predetermined predetermined participant predetermined Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263922X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip autoradiography autoradiography Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263908X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263906X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. Only protein-protein interactions in vitro In vitro hydroxylase assay hydroxylase assay predetermined predetermined participant predetermined Cockman ME., Lancaster DE., Stolze IP., Hewitson KS., McDonough MA., Coleman ML., Coles CH., Yu X., Hay RT., Ley SC., Pugh CW., Oldham NJ., Masson N., Schofield CJ., Ratcliffe PJ. DIP original experiment: DIP-263914X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Posttranslational hydroxylation of ankyrin repeats in IkappaB proteins by the hypoxia-inducible factor (HIF) asparaginyl hydroxylase, factor inhibiting HIF (FIH). hif1n_human Hypoxia-inducible factor 1-alpha inhibitor Hypoxia-inducible factor asparagine hydroxylase Factor inhibiting HIF-1 HIF1AN FIH1 protein protein human Homo sapiens Human MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN DIP protein Q9NWT6 original sequence version: 144 DIP protein Q9NWT6 original sequence version: 135 96A033BA7B3BD8C7 tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 tnks1_human Poly [ADP-ribose] polymerase tankyrase-1 TNKS PARP5A PARPL TIN1 TINF1 TNKS1 Tankyrase I TNKS-1 TRF1-interacting ankyrin-related ADP-ribose polymerase Poly [ADP-ribose] polymerase 5A ADP-ribosyltransferase diphtheria toxin-like 5 Protein poly-ADP-ribosyltransferase tankyrase-1 Tankyrase-1 protein protein human Homo sapiens Human MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTASGLAPFASPRHGLALPEGDGSRDPPDRPRSPDPVDGTSCCSTTSTICTVAAAPVVPAVSTSSAAGVAPNPAGSGSNNSPSSSSSPTSSSSSSPSSPGSSLAESPEAAGVSSTAPLGPGAAGPGTGVPAVSGALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAALAGHLQTCRLLLSYGSDPSIISLQGFTAAQMGNEAVQQILSESTPIRTSDVDYRLLEASKAGDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLIDAMPPEALPTCFKPQATVVSASLISPASTPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERKEGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPSQTATAAEQKT DIP protein O95271 original sequence version: 148 DIP protein O95271 original sequence version: 149 DIP protein O95271-1 original sequence version: 113 44BDE985C715BEFF mypt1_human Protein phosphatase 1 regulatory subunit 12A PPP1R12A MBS MYPT1 Myosin phosphatase-targeting subunit 1 Protein phosphatase myosin-binding subunit protein protein human Homo sapiens Human MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWTPLHAAAHWGKEEACRILVDNLCDMEMVNKVGQTAFDVADEDILGYLEELQKKQNLLHSEKRDKKSPLIESTANMDNNQSQKTFKNKETLIIEPEKNASRIESLEQEKVDEEEEGKKDESSCSSEEDEEDDSESEAETDKTKPLASVTNANTSSTQAAPVAVTTPTVSSGQATPTSPIKKFPTTATKISPKEEERKDESPATWRLGLRKTGSYGALAEITASKEGQKEKDTAGVTRSASSPRLSSSLDNKEKEKDSKGTRLAYVAPTIPRRLASTSDIEEKENRDSSSLRTSSSYTRRKWEDDLKKNSSVNEGSTYHKSCSFGRRQDDLISSSVPSTTSTPTVTSAAGLQKSLLSSTSTTTKITTGSSSAGTQSSTSNRLWAEDSTEKEKDSVPTAVTIPVAPTVVNAAASTTTLTTTTAGTVSSTTEVRERRRSYLTPVRDEESESQRKARSRQARQSRRSTQGVTLTDLQEAEKTIGRSRSTRTREQENEEKEKEEKEKQDKEKQEEKKESETSREDEYKQKYSRTYDETYQRYRPVSTSSSTTPSSSLSTMSSSLYASSQLNRPNSLVGITSAYSRGITKENEREGEKREEEKEGEDKSQPKSIRERRRPREKRRSTGVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSAGDRYDSLLGRSGSYSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEKLKAQLHDTNMELTDLKLQLEKATQRQERFADRSLLEMEKRERRALERRISEMEEELKMLPDLKADNQRLKDENGALIRVISKLSK DIP protein O14974 original sequence version: 95 DIP protein O14974 original sequence version: 141 EA43E9BFF5DA08FF ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL DIP protein P25963 original sequence version: 160 DIP protein P25963 original sequence version: 157 DIP protein P25963 original sequence version: 145 DIP protein P25963 original sequence version: 170 DIP protein P25963 original sequence version: 122 DIP protein P25963 original sequence version: 128 DIP protein P25963 original sequence version: 78 DIP protein P25963 original sequence version: 121 DIP protein P25963 original sequence version: 124 088B313226786395 psd10_human 26S proteasome non-ATPase regulatory subunit 10 26S proteasome regulatory subunit p28 Gankyrin PSMD10 p28(GANK) protein protein human Homo sapiens Human MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG DIP protein O75832 original sequence version: 149 57158E33146EC7C8 nfkb1_human Nuclear factor NF-kappa-B p105 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMMSNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQAHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGKI DIP protein P19838 original sequence version: 202 DIP protein P19838 original sequence version: 192 DIP protein P19838 original sequence version: 195 2A7C8FF86A10D1A8 fem1b_human Protein fem-1 homolog B FEM1B KIAA0396 F1AA FEM1-beta Fem-1-like death receptor-binding protein alpha Fem-1-like in apoptotic pathway protein alpha protein protein human Homo sapiens Human MEGLAGYVYKAASEGKVLTLAALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGHAKVVRLLLEHYRVQTQQTGTVRFDGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVTNSTPLRAACFDGRLDIVKYLVENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQRADPNAKAHCGATALHFAAEAGHIDIVKELIKWRAAIVVNGHGMTPLKVAAESCKADVVELLLSHADCDRRSRIEALELLGASFANDRENYDIIKTYHYLYLAMLERFQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIYRGAVYADNMEFEQCIKLWLHALHLRQKGNRNTHKDLLRFAQVFSQMIHLNETVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHLAVNSNTPVDDFHTNDVCSFPNALVTKLLLDCGAEVNAVDNEGNSALHIIVQYNRPISDFLTLHSIIISLVEAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEEFVGFH DIP protein Q9UK73 original sequence version: 122 85DA943663A988C1 anr49_human Ankyrin repeat domain-containing protein 49 ANKRD49 FGIF Fetal globin-inducing factor protein protein human Homo sapiens Human MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYRLQEKKMEKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQS DIP protein Q8WVL7 original sequence version: 103 97103467E8F1EA50 uaca_human Uveal autoantigen with coiled-coil domains and ankyrin repeats UACA KIAA1561 protein protein human Homo sapiens Human MKSLKSRLRRQDVPGPASSGAAAASAHAADWNKYDDRLMKAAERGDVEKVTSILAKKGVNPGKLDVEGRSVFHVVTSKGNLECLNAILIHGVDITTSDTAGRNALHLAAKYGHALCLQKLLQYNCPTEHADLQGRTALHDAAMADCPSSIQLLCDHGASVNAKDVDGRTPLVLATQMSRPTICQLLIDRGADVNSRDKQNRTALMLGCEYGCRDAVEVLIKNGADISLLDALGHDSSYYARIGDNLDILTLLKTASENTNKGRELWKKGPSLQQRNLTHMQDEVNVKSHQREHQNIQDLEIENEDLKERLRKIQQEQRILLDKVNGLQLQLNEEVMVADDLESEREKLKSLLAAKEKQHEESLRTIEALKNRFKYFESDHLGSGSHFSNRKEDMLLKQGQMYMADSQCTSPGIPAHMQSRSMLRPLELSLPSQTSYSENEILKKELEAMRTFCESAKQDRLKLQNELAHKVAECKALALECERVKEDSDEQIKQLEDALKDVQKRMYESEGKVKQMQTHFLALKEHLTSEAASGNHRLTEELKDQLKDLKVKYEGASAEVGKLRNQIKQNEMIVEEFKRDEGKLIEENKRLQKELSMCEMEREKKGRKVTEMEGQAKELSAKLALSIPAEKFENMKSSLSNEVNEKAKKLVEMEREHEKSLSEIRQLKRELENVKAKLAQHVKPEEHEQVKSRLEQKSGELGKKITELTLKNQTLQKEIEKVYLDNKLLKEQAHNLTIEMKNHYVPLKVSEDMKKSHDAIIDDLNRKLLDVTQKYTEKKLEMEKLLLENDSLSKDVSRLETVFVPPEKHEKEIIALKSNIVELKKQLSELKKKCGEDQEKIHALTSENTNLKKMMSNQYVPVKTHEEVKMTLNDTLAKTNRELLDVKKKFEDINQEFVKIKDKNEILKRNLENTQNQIKAEYISLAEHEAKMSSLSQSMRKVQDSNAEILANYRKGQEEIVTLHAEIKAQKKELDTIQECIKVKYAPIVSFEECERKFKATEKELKDQLSEQTQKYSVSEEEVKKNKQENDKLKKEIFTLQKDLRDKTVLIEKSHEMERALSRKTDELNKQLKDLSQKYTEVKNVKEKLVEENAKQTSEILAVQNLLQKQHVPLEQVEALKKSLNGTIENLKEELKSMQRCYEKEQQTVTKLHQLLENQKNSSVPLAEHLQIKEAFEKEVGIIKASLREKEEESQNKMEEVSKLQSEVQNTKQALKKLETREVVDLSKYKATKSDLETQISSLNEKLANLNRKYEEVCEEVLHAKKKEISAKDEKELLHFSIEQEIKDQKERCDKSLTTITELQRRIQESAKQIEAKDNKITELLNDVERLKQALNGLSQLTYTSGNPTKRQSQLIDTLQHQVKSLEQQLADADRQHQEVIAIYRTHLLSAAQGHMDEDVQEALLQIIQMRQGLVC DIP protein Q9BZF9 original sequence version: 110 92C1104445FB0009 gabp1_human GA-binding protein subunit beta-1 GABP subunit beta-2 Transcription factor E4TF1-53 Transcription factor E4TF1-47 Nuclear respiratory factor 2 GABPB1 E4TF1B GABPB GABPB2 protein protein human Homo sapiens Human MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGHYSTTEVLLRAGVSRDARTKVDRTPLHMAASEGHASIVEVLLKHGADVNAKDMLKMTALHWATEHNHQEVVELLIKYGADVHTQSKFCKTAFDISIDNGNEDLAEILQIAMQNQINTNPESPDTVTIHAATPQFIIGPGGVVNLTGLVSSENSSKATDETGVSAVQFGNSSTSVLATLAALAEASAPLSNSSETPVVATEEVVTAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGIGQPIIVTMPDGQQVLTVPATDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRLQTNKEAV DIP protein Q06547 original sequence version: 155 DIP protein Q06547 original sequence version: 158 723D63962FB29BD9 mtpn_human Myotrophin Protein V-1 MTPN protein protein human Homo sapiens Human MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ DIP protein P58546 original sequence version: 84 DIP protein P58546 original sequence version: 119 9097FFDF61D329A2 cdn2d_human Cyclin-dependent kinase 4 inhibitor D p19-INK4d CDKN2D protein protein human Homo sapiens Human MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL DIP protein P55273 original sequence version: 138 2FACD11CF56340DC ilk_human Integrin-linked protein kinase ILK-1 ILK-2 59 kDa serine/threonine-protein kinase p59ILK ILK ILK1 ILK2 Beta-integrin-linked kinase protein protein human Homo sapiens Human MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK DIP protein Q13418 original sequence version: 114 DIP protein Q13418 original sequence version: 163 E37DC2AD5311A1C2 hif1a_human Hypoxia-inducible factor 1-alpha ARNT-interacting protein Member of PAS protein 1 Basic-helix-loop-helix-PAS protein MOP1 HIF1A MOP1 BHLHE78 PASD8 PAS domain-containing protein 8 Class E basic helix-loop-helix protein 78 protein protein human Homo sapiens Human MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVTVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN DIP protein Q16665 original sequence version: 94 DIP protein Q16665 original sequence version: 98 DIP protein Q16665-1 original sequence version: 102 DIP protein Q16665 original sequence version: 102 DIP protein Q16665 original sequence version: 127 DIP protein Q16665 original sequence version: 120 DIP protein Q16665 original sequence version: 169 DIP protein Q16665 original sequence version: 174 DIP protein Q16665-1 original sequence version: 174 DIP protein Q16665-1 original sequence version: 191 DIP protein Q16665 original sequence version: 191 DIP protein Q16665 original sequence version: 179 DIP protein Q16665 original sequence version: 150 DIP protein Q16665 original sequence version: 156 DIP protein Q16665 original sequence version: 177 ABD4F7DAA135BE2D hif1an-mtpn-1 6 40 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 47-66 Region 47-66 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N(OH) N(OH) 3hyasn 3-hydroxy-L-asparagine monohydroxylated asparagine 3HyAsn Oxidation hydroxylationn modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm in vitro In vitro 29 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli hydroxylation hydroxylation reaction hydroxylation hif1an-nfkb1-1 3 35 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association fem1b-hif1an-1 22 36 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 511-531 Region 511-531 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N(OH) N(OH) 3hyasn 3-hydroxy-L-asparagine monohydroxylated asparagine 3HyAsn Oxidation hydroxylationn modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm in vitro In vitro 29 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli hydroxylation hydroxylation reaction hydroxylation nfkbia-nfkb1-1 27 30 unspecified role unspecified role prey prey human Homo sapiens Human 35 unspecified role unspecified role prey prey human Homo sapiens Human 33 unspecified role unspecified role bait bait human Homo sapiens Human association association hif1an-uaca-1 9 38 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association hif1an-ilk-1 2 42 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 79-99 Region 79-99 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N(OH) N(OH) 3hyasn 3-hydroxy-L-asparagine monohydroxylated asparagine 3HyAsn Oxidation hydroxylationn modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm in vitro In vitro 29 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli hydroxylation hydroxylation reaction hydroxylation hif1an-nfkbia-1 15 33 enzyme target enzyme target substrate substrate unspecified role unspecified role N(OH) N(OH) 3hyasn 3-hydroxy-L-asparagine monohydroxylated asparagine 3HyAsn Oxidation hydroxylationn modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm Region 229-248 Region 229-248 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 29 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli hydroxylation hydroxylation reaction hydroxylation hif1an-uaca-2 17 38 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 29 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association hif1an-fem1b-1 10 36 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 29 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association hif1an-nfkb1-2 14 35 unspecified role unspecified role prey prey Region 542-803 Region 542-803 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 29 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association gabpb1-hif1an-1 24 39 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 83-102 Region 83-102 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N(OH) N(OH) 3hyasn 3-hydroxy-L-asparagine monohydroxylated asparagine 3HyAsn Oxidation hydroxylationn modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm in vitro In vitro 29 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli hydroxylation hydroxylation reaction hydroxylation hif1an-fem1b-2 26 36 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 29 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association hif1an-nfkb1-3 20 35 unspecified role unspecified role unspecified role unspecified role Region 537-809 Region 537-809 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction nfkb1-hif1an-1 8 29 unspecified role unspecified role prey prey human Homo sapiens Human 35 unspecified role unspecified role bait bait V5-tag V5-tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P19838:p.Asn678Ala N678A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain N A This feature has been corrected as a result of our quality control procedures. The original label was 'N678A'. Wed May 02 15:25:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn678ala' Tue Jun 30 15:57:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn678Ala' human Homo sapiens Human physical association physical association hif1an-nfkbia-2 19 33 enzyme target enzyme target substrate substrate unspecified role unspecified role N(OH) N(OH) 3hyasn 3-hydroxy-L-asparagine monohydroxylated asparagine 3HyAsn Oxidation hydroxylationn modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm ecolx Escherichia coli 29 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli hydroxylation hydroxylation reaction hydroxylation cdkn2d-hif1an-1 23 41 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 86-105 Region 86-105 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N(OH) N(OH) 3hyasn 3-hydroxy-L-asparagine monohydroxylated asparagine 3HyAsn Oxidation hydroxylationn modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm in vitro In vitro 29 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli hydroxylation hydroxylation reaction hydroxylation hif1a-hif1an-6 4 43 unspecified role unspecified role unspecified role unspecified role Region 775-826 Region 775-826 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction nfkb1-hif1an-2 13 29 unspecified role unspecified role prey prey human Homo sapiens Human 35 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association hif1an-psmd10-1 1 34 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 85-104 Region 85-104 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N(OH) N(OH) 3hyasn 3-hydroxy-L-asparagine monohydroxylated asparagine 3HyAsn Oxidation hydroxylationn modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm in vitro In vitro 29 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli hydroxylation hydroxylation reaction hydroxylation hif1an-nfkbia-3 11 33 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association hif1a-hif1an-7 7 43 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 788-806 Region 788-806 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N(OH) N(OH) 3hyasn 3-hydroxy-L-asparagine monohydroxylated asparagine 3HyAsn Oxidation hydroxylationn modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm in vitro In vitro 29 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli hydroxylation hydroxylation reaction hydroxylation hif1an-tnks-1 16 31 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 849-868 Region 849-868 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N(OH) N(OH) 3hyasn 3-hydroxy-L-asparagine monohydroxylated asparagine 3HyAsn Oxidation hydroxylationn modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm in vitro In vitro 29 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli hydroxylation hydroxylation reaction hydroxylation hif1an-nfkb1-4 12 35 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 663-683 Region 663-683 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N(OH) N(OH) 3hyasn 3-hydroxy-L-asparagine monohydroxylated asparagine 3HyAsn Oxidation hydroxylationn modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm in vitro In vitro 29 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli hydroxylation hydroxylation reaction hydroxylation nfkbia-nfkb1-2 18 35 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 33 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association ankrd49-hif1an-1 25 37 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 153-172 Region 153-172 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N(OH) N(OH) 3hyasn 3-hydroxy-L-asparagine monohydroxylated asparagine 3HyAsn Oxidation hydroxylationn modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm in vitro In vitro 29 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli hydroxylation hydroxylation reaction hydroxylation hif1an-nfkbia-4 28 33 enzyme target enzyme target substrate substrate unspecified role unspecified role N(OH) N(OH) 3hyasn 3-hydroxy-L-asparagine monohydroxylated asparagine 3HyAsn Oxidation hydroxylationn modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm Region 195-215 Region 195-215 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 29 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli hydroxylation hydroxylation reaction hydroxylation nfkbia-rela-5 5 30 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 33 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association hif1an-ppp1r12a-1 21 32 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 211-230 Region 211-230 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain N(OH) N(OH) 3hyasn 3-hydroxy-L-asparagine monohydroxylated asparagine 3HyAsn Oxidation hydroxylationn modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm in vitro In vitro 29 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli hydroxylation hydroxylation reaction hydroxylation