DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. DIP original experiment: DIP-263858X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress pull down pull down western blot western blot Immuno blot Immuno blot Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. DIP original experiment: DIP-263864X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. DIP original experiment: DIP-263859X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. DIP original experiment: DIP-263860X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. DIP original experiment: DIP-263862X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. DIP original experiment: DIP-263856X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. DIP original experiment: DIP-263863X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. DIP original experiment: DIP-263857X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wood CC., Robertson M., Tanner G., Peacock WJ., Dennis ES., Helliwell CA. DIP original experiment: DIP-263861X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The Arabidopsis thaliana vernalization response requires a polycomb-like protein complex that also includes VERNALIZATION INSENSITIVE 3. fie_arath Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM FIE FIS3 At3g20740 MOE17.5 Protein FERTILIZATION-INDEPENDENT SEED 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKITLGNESIVGSLTPSNKKSYKVTNRIQEGKKPLYAVVFNFLDARFFDVFVTAGGNRITLYNCLGDGAISALQSYADEDKEESFYTVSWACGVNGNPYVAAGGVKGIIRVIDVNSETIHKSLVGHGDSVNEIRTQPLKPQLVITASKDESVRLWNVETGICILIFAGAGGHRYEVLSVDFHPSDIYRFASCGMDTTIKIWSMKEFWTYVEKSFTWTDDPSKFPTKFVQFPVFTASIHTNYVDCNRWFGDFILSKSVDNEILLWEPQLKENSPGEGASDVLLRYPVPMCDIWFIKFSCDLHLSSVAIGNQEGKVYVWDLKSCPPVLITKLSHNQSKSVIRQTAMSVDGSTILACCEDGTIWRWDVITK DIP protein Q9LT47 original sequence version: 126 DIP protein Q9LT47 original sequence version: 91 EDF0989C02B4FD4A clf_arath Histone-lysine N-methyltransferase CLF CLF At2g23380 F26B6.3 ICU1 PIF1 PIF2 SDG1 SET1 Protein INCURVATA 1 Protein photoperiod insensitive flowering Protein SET DOMAIN GROUP 1 Polycomb group protein CURLY LEAF protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASEASPSSSATRSEPPKDSPAEERGPASKEVSEVIESLKKKLAADRCISIKKRIDENKKNLFAITQSFMRSSMERGGSCKDGSDLLVKRQRDSPGMKSGIDESNNNRYVEDGPASSGMVQGSSVPVKISLRPIKMPDIKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEAIDDEEEKRDFLEPEDYIIRMTLEQLGLSDSVLAELASFLSRSTSEIKARHGVLMKEKEVSESGDNQAESSLLNKDMEGALDSFDNLFCRRCLVFDCRLHGCSQDLIFPAEKPAPWCPPVDENLTCGANCYKTLLKSGRFPGYGTIEGKTGTSSDGAGTKTTPTKFSSKLNGRKPKTFPSESASSNEKCALETSDSENGLQQDTNSDKVSSSPKVKGSGRRVGRKRNKNRVAERVPRKTQKRQKKTEASDSDSIASGSCSPSDAKHKDNEDATSSSQKHVKSGNSGKSRKNGTPAEVSNNSVKDDVPVCQSNEVASELDAPGSDESLRKEEFMGETVSRGRLATNKLWRPLEKSLFDKGVEIFGMNSCLIARNLLSGFKSCWEVFQYMTCSENKASFFGGDGLNPDGSSKFDINGNMVNNQVRRRSRFLRRRGKVRRLKYTWKSAAYHSIRKRITEKKDQPCRQFNPCNCKIACGKECPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWVIGGDGSLGVPSQRGDNYECRNMKLLLKQQQRVLLGISDVSGWGAFLKNSVSKHEYLGEYTGELISHKEADKRGKIYDRENCSFLFNLNDQFVLDAYRKGDKLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWAKKPEAPGSKKDENVTPSVGRPKKLA DIP protein P93831 original sequence version: 119 DIP protein P93831 original sequence version: 96 DIP protein P93831 original sequence version: 99 DIP protein P93831 original sequence version: 88 90B45ED27D219D64 eza1_arath Histone-lysine N-methyltransferase EZA1 EZA1 SDG10 SET10 CURLY LEAF-like 1 Protein SET DOMAIN GROUP 10 Protein SWINGER SWN T10M13.3 At4g02020 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVTDDSNSSGRIKSHVDDDDDGEEEEDRLEGLENRLSELKRKIQGERVRSIKEKFEANRKKVDAHVSPFSSAASSRATAEDNGNSNMLSSRMRMPLCKLNGFSHGVGDRDYVPTKDVISASVKLPIAERIPPYTTWIFLDRNQRMAEDQSVVGRRQIYYEQHGGETLICSDSEEEPEPEEEKREFSEGEDSIIWLIGQEYGMGEEVQDALCQLLSVDASDILERYNELKLKDKQNTEEFSNSGFKLGISLEKGLGAALDSFDNLFCRRCLVFDCRLHGCSQPLISASEKQPYWSDYEGDRKPCSKHCYLQLKAVREVPETCSNFASKAEEKASEEECSKAVSSDVPHAAASGVSLQVEKTDIGIKNVDSSSGVEQEHGIRGKREVPILKDSNDLPNLSNKKQKTAASDTKMSFVNSVPSLDQALDSTKGDQGGTTDNKVNRDSEADAKEVGEPIPDNSVHDGGSSICQPHHGSGNGAIIIAEMSETSRPSTEWNPIEKDLYLKGVEIFGRNSCLIARNLLSGLKTCLDVSNYMRENEVSVFRRSSTPNLLLDDGRTDPGNDNDEVPPRTRLFRRKGKTRKLKYSTKSAGHPSVWKRIAGGKNQSCKQYTPCGCLSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAAGRECDPDVCRNCWVSCGDGSLGEAPRRGEGQCGNMRLLLRQQQRILLGKSDVAGWGAFLKNSVSKNEYLGEYTGELISHHEADKRGKIYDRANSSFLFDLNDQYVLDAQRKGDKLKFANHSAKPNCYAKVMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPVWARKPEGSKKDDSAITHRRARKHQSH DIP protein Q9ZSM8 original sequence version: 120 DIP protein Q9ZSM8 original sequence version: 81 DD4B099C936F197C vrn2_arath Polycomb group protein VERNALIZATION 2 VRN2 dl4450w FCAALL.23 At4g16845 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MCRQNCRAKSSPEEVISTDENLLIYCKPVRLYNIFHLRSLGNPSFLPRCLNYKIGAKRKRKSRSTGMVVFNYKDCNNTLQRTEVREDCSCPFCSMLCGSFKGLQFHLNSSHDLFEFEFKLLEEYQTVNVSVKLNSFIFEEEGSDDDKFEPFSLCSKPRKRRQRGGRNNTRRLKVCFLPLDSPSLANGTENGIALLNDGNRGLGYPEATELAGQFEMTSNIPPAIAHSSLDAGAKVILTTEAVVPATKTRKLSAERSEARSHLLLQKRQFYHSHRVQPMALEQVMSDRDSEDEVDDDVADFEDRQMLDDFVDVNKDEKQFMHLWNSFVRKQRVIADGHISWACEVFSRFYEKELHCYSSLFWCWRLFLIKLWNHGLVDSATINNCNTILENCRNTSVTNNNNNSVDHPSDSNTNNNNIVDHPNDIKNKNNVDNKDNNSRDK DIP protein Q8W5B1 original sequence version: 97 DIP protein Q8W5B1 original sequence version: 65 0E0AB2C55517BE6F vin3_arath Protein VERNALIZATION INSENSITIVE 3 VIN3 MSF19.4 At5g57380 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQAASLSKIWRFDGNVGPENMDSSSFEDNECIETCKPNVLNVSERRELIHALSNQPEEASELLNSWSRNEIMKIICAEMGKERKYTGLNKPKLIENLLNLVSRPLGETSCSDRRNSRKKEKKMIGYIICCENLACRAALGCDDTFCRRCSCCICQKFDDNKDPSLWLTCDACGSSCHLECGLKQDRYGIGSDDLDGRFYCAYCGKDNDLLGCWRKQVKVAKETRRVDVLCYRLSLGQKLLRGTTKYRNLLELMDEAVKKLEGDVGPLSGWAMKMARGIVNRLSSGVHVQKLCSQAMEALDKVVSPSESVSGQGDKMTVRVEEIQARSVTVRVDSEEPSSSTQNKITGFRLFCRKSKDEECSSQGNCVVYLPETTSAIQGLEPDTEFCLRVVSFNEEGDLDESELRFTTLKDDGDEAGDQQSPLTNSSSGLCSNPSLPEDESNNVNKSCSKGNGDKDNTEHCSAGEVESELEEERLVKRKANKIDGRDLLVTPCKRDIYKGKQGGNKRFKSRTVSLNEKPEINNAANGVGDKDLGHIVKTIRCLEEEGHIDKSFRERFLTWYSLRATHREVRVVKIFVETFMEDLSSLGQQLVDTFSESILSKRSSTNGVVPAGICLKLWH DIP protein Q9FIE3 original sequence version: 110 DIP protein Q9FIE3 original sequence version: 70 C145D4E88D3BD588 vrn2-vin3-1 1 14 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 13 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association vrn2-clf-1 6 11 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 13 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association vin3-vrn2-1 5 14 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 13 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association clf-vrn2-2 4 11 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 13 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association vrn2-fie-1 2 10 unspecified role unspecified role prey prey arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 13 unspecified role unspecified role bait bait CBP-tag CBP-tag cam tag calmodulin binding protein tag cam tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association vrn2-fie-2 3 10 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 13 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association vrn2-eza1-1 8 12 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 13 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association fie-vrn2-1 7 10 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 13 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association eza1-vrn2-1 9 12 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress 13 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress physical association physical association