DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. DIP original experiment: DIP-264116X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. DIP original experiment: DIP-264121X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. DIP original experiment: DIP-264111X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. DIP original experiment: DIP-264115X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. Only protein-protein interactions human Homo sapiens Human pull down pull down anti tag western anti tag western blot anti tag western Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. DIP original experiment: DIP-264117X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. Only protein-protein interactions human Homo sapiens Human pull down pull down predetermined predetermined participant predetermined Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. DIP original experiment: DIP-264120X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. DIP original experiment: DIP-264119X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. DIP original experiment: DIP-264114X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. DIP original experiment: DIP-264112X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. Only protein-protein interactions human Homo sapiens Human pull down pull down predetermined predetermined participant predetermined Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. DIP original experiment: DIP-264118X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. DIP original experiment: DIP-264111X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Gu C., Tangye SG., Sun X., Luo Y., Lin Z., Wu J. DIP original experiment: DIP-264113X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The X-linked lymphoproliferative disease gene product SAP associates with PAK-interacting exchange factor and participates in T cell activation. p60953-2 Cell division control protein 42 homolog CDC42 G25K GTP-binding protein Placental protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL DIP protein P60953-2 original sequence version: 152 DIP protein P60953 original sequence version: 98 DIP protein P60953 original sequence version: 148 DIP protein P60953 original sequence version: 142 DIP protein P60953-2 original sequence version: 135 DIP protein P60953 original sequence version: 99 DIP protein P60953-2 original sequence version: 139 DIP protein P60953 original sequence version: 144 DIP protein P60953 original sequence version: 163 DIP protein P60953 original sequence version: 158 DIP protein P60953-2 original sequence version: 147 DIP protein P60953 original sequence version: 123 51A437E22A4D8FFF arhg7_human Rho guanine nucleotide exchange factor 7 PAK-interacting exchange factor beta Beta-Pix COOL-1 p85 Nbla10314 ARHGEF7 COOL1 KIAA0142 P85SPR PAK3BP PIXB protein protein human Homo sapiens Human MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNIREFLRGCGASLRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDLSEDSDYDSIWTAHSYRMGSTSRKSCCSYISHQN DIP protein Q14155 original sequence version: 163 DIP protein Q14155 original sequence version: 159 613EBA839E6FDBFD o60880-1 SH2 domain-containing protein 1A Duncan disease SH2-protein Signaling lymphocytic activation molecule-associated protein T-cell signal transduction molecule SAP SH2D1A DSHP SAP protein protein human Homo sapiens Human MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP DIP protein O60880-1 original sequence version: 142 DIP protein O60880 original sequence version: 130 slaf1_human Signaling lymphocytic activation molecule SLAMF1 SLAM family member 1 SLAM CDw150 IPO-3 protein protein human Homo sapiens Human MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES DIP protein Q13291 original sequence version: 151 DIP protein Q13291 original sequence version: 110 DIP protein Q13291 original sequence version: 106 DIP protein Q13291 original sequence version: 112 BFB0F27EA31D8C04 cd244_human Natural killer cell receptor 2B4 NK cell type I receptor protein 2B4 NK cell activation-inducing ligand CD244 2B4 SLAM family member 4 Signaling lymphocytic activation molecule 4 protein protein human Homo sapiens Human MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSRKELENFDVYS DIP protein Q9BZW8 original sequence version: 134 DIP protein Q9BZW8 original sequence version: 125 959FF8DBB0BACC87 arhg6_human Rho guanine nucleotide exchange factor 6 ARHGEF6 COOL2 KIAA0006 PIXA Rac/Cdc42 guanine nucleotide exchange factor 6 PAK-interacting exchange factor alpha Alpha-Pix COOL-2 protein protein human Homo sapiens Human MNPEEQIVTWLISLGVLESPKKTICDPEEFLKSSLKNGVVLCKLINRLMPGSVEKFCLDPQTEADCINNINDFLKGCATLQVEIFDPDDLYSGVNFSKVLSTLLAVNKATEDQLSERPCGRSSSLSAANTSQTNPQGAVSSTVSGLQRQSKTVEMTENGSHQLIVKARFNFKQTNEDELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAVKGFETAPLTKNYYTVVLQNILDTEKEYAKELQSLLVTYLRPLQSNNNLSTVEVTSLLGNFEEVCTFQQTLCQALEECSKFPENQHKVGGCLLSLMPHFKSMYLAYCANHPSAVNVLTQHSDELEQFMENQGASSPGILILTTNLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIVAFKTLMGQCQDLRKRKQLELQILSEPIQAWEGEDIKNLGNVIFMSQVMVQYGACEEKEERYLMLFSNVLIMLSASPRMSGFIYQGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIVVHCNNNQDFQEWLEQLNRLIRGPASCSSLSKTSSSSCSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLRPSAALGYKERMSYILKESSKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEEDAQILKVIEAYCTSANFQQGHGSSTRKDSIPQVLLPEEEKLIIEETRSNGQTIMEEKSLVDTVYALKDEVRELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECIRGESSSKTSILP DIP protein Q15052 original sequence version: 165 5D2622314E46341B fyn_human Tyrosine-protein kinase Fyn p59-Fyn Proto-oncogene c-Fyn Src-like kinase FYN Proto-oncogene Syn protein protein human Homo sapiens Human MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL DIP protein P06241 original sequence version: 195 DIP protein P06241 original sequence version: 147 DIP protein P06241 original sequence version: 164 4A1E443A4B5A0977 sh2d1a-arhgef6-1 11 15 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 18 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association arhgef6-sh2d1a-1 5 15 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 18 unspecified role unspecified role bait bait Region 160-219 Region 160-219 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association sh2d1a-arhgef7-1 8 14 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q14155:p.Trp221_Trp222delinsProGly W43P/W44G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain WW PG Wed May 02 14:55:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp_trp221-222pro_gly' Tue Jun 30 17:15:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp221_Trp222delinsProGly' human Homo sapiens Human 15 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association sh2d1a-fyn-1 7 19 unspecified role unspecified role prey prey P06241:p.Pro134Leu P134L mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain P L This feature has been corrected as a result of our quality control procedures. The original label was 'P134L'. Wed May 02 19:52:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro134leu' Tue Jun 30 17:23:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro134Leu' Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range P06241:p.[Trp119Pro;Trp120Gly] W119P/W120G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain W G certain certain sequence position certain certain certain sequence position certain W P This feature has been corrected as a result of our quality control procedures. The original label was 'W119P/W120G'. Wed May 02 17:58:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp119pro,trp120gly' Tue Jun 30 18:21:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp119Pro;Trp120Gly]' human Homo sapiens Human 15 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association sh2d1a-arhgef7-2 9 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association cd244-arhgef7-1 1 17 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 14 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association cdc42-arhgef7-1 6 13 unspecified role unspecified role bait bait P60953-2:p.Thr17Asn T17N mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain T N This feature has been corrected as a result of our quality control procedures. The original label was 'T17N'. Wed May 02 20:22:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr17asn' Tue Jun 30 16:50:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr17Asn' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 14 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human association association arhgef7-sh2d1a-2 10 14 unspecified role unspecified role bait bait Region 184-243 Region 184-243 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association sh2d1a-arhgef6-2 12 15 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 18 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association sh2d1a-arhgef7-3 2 14 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 15 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O60880-1:p.Arg78Ala R78A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R78A'. Wed May 02 15:47:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg78ala' Tue Jun 30 20:11:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg78Ala' human Homo sapiens Human physical association physical association sh2d1a-arhgef7-4 4 14 unspecified role unspecified role prey prey human Homo sapiens Human 15 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association sh2d1a-slamf1-15 3 16 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association