DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Coactosin-like protein supports 5-lipoxygenase enzyme activity and up-regulates leukotriene A4 production. Coactosin-like protein supports 5-lipoxygenase enzyme activity and up-regulates leukotriene A4 production. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Rakonjac M., Fischer L., Provost P., Werz O., Steinhilber D., Samuelsson B., Rådmark O. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Rakonjac M., Fischer L., Provost P., Werz O., Steinhilber D., Samuelsson B., Rådmark O. DIP original experiment: DIP-263730X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Coactosin-like protein supports 5-lipoxygenase enzyme activity and up-regulates leukotriene A4 production. cotl1_human Coactosin-like protein COTL1 CLP protein protein human Homo sapiens Human MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE DIP protein Q14019 original sequence version: 130 A4B881DD8E89A35D lox5_human Polyunsaturated fatty acid 5-lipoxygenase ALOX5 LOG5 Arachidonate 5-lipoxygenase protein protein human Homo sapiens Human MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDFHVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECGLFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWEAIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYLTVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCWHLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPYYYLSPDRIPNSVAI DIP protein P09917 original sequence version: 164 36F38C0A9E86BB21 cotl1-alox5-5 1 3 unspecified role unspecified role prey prey P09917:p.[Trp14Ala;Trp76Ala;Trp103Ala] W14A/W76A/W103A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W14A/W76A/W103A'. Wed May 02 19:49:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp14ala,trp76ala,trp103ala' Tue Jun 30 18:23:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp14Ala;Trp76Ala;Trp103Ala]' ecolx Escherichia coli 2 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction