DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. Nature structural & molecular biology 2006 imex curation Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. Only protein-protein interactions in vitro In vitro coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. DIP original experiment: DIP-66537X Nature structural & molecular biology 2006 IMEx The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. Nature structural & molecular biology 2006 imex curation Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. Only protein-protein interactions in vitro In vitro coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. DIP original experiment: DIP-66533X Nature structural & molecular biology 2006 IMEx The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. Nature structural & molecular biology 2006 imex curation Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. DIP original experiment: DIP-66539X Nature structural & molecular biology 2006 IMEx The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. Nature structural & molecular biology 2006 imex curation Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. Only protein-protein interactions ecolx Escherichia coli coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. DIP original experiment: DIP-66531X Nature structural & molecular biology 2006 IMEx The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. Nature structural & molecular biology 2006 imex curation Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. Only protein-protein interactions in vitro In vitro coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. DIP original experiment: DIP-66536X Nature structural & molecular biology 2006 IMEx The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. Nature structural & molecular biology 2006 imex curation Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. Only protein-protein interactions ecolx Escherichia coli coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. DIP original experiment: DIP-66530X Nature structural & molecular biology 2006 IMEx The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. Nature structural & molecular biology 2006 imex curation Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. Only protein-protein interactions ecolx Escherichia coli ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. DIP original experiment: DIP-66528X Nature structural & molecular biology 2006 IMEx The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. Nature structural & molecular biology 2006 imex curation Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. Only protein-protein interactions in vitro In vitro coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. DIP original experiment: DIP-66532X Nature structural & molecular biology 2006 IMEx The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. Nature structural & molecular biology 2006 imex curation Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. DIP original experiment: DIP-66527X Nature structural & molecular biology 2006 IMEx The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. Nature structural & molecular biology 2006 imex curation Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. Only protein-protein interactions in vitro In vitro coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. DIP original experiment: DIP-66534X Nature structural & molecular biology 2006 IMEx The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. Nature structural & molecular biology 2006 imex curation Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. DIP original experiment: DIP-66538X Nature structural & molecular biology 2006 IMEx The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. Nature structural & molecular biology 2006 imex curation Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. Only protein-protein interactions in vitro In vitro coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. DIP original experiment: DIP-66535X Nature structural & molecular biology 2006 IMEx The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. Nature structural & molecular biology 2006 imex curation Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Haruta N., Kurokawa Y., Murayama Y., Akamatsu Y., Unzai S., Tsutsui Y., Iwasaki H. DIP original experiment: DIP-66529X Nature structural & molecular biology 2006 IMEx The Swi5-Sfr1 complex stimulates Rhp51/Rad51- and Dmc1-mediated DNA strand exchange in vitro. rfa3_schpo Replication factor A protein 3 ssb3 Single-stranded DNA-binding protein P12 subunit SPCC23B6.05c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MERPTPRVTKDMLPECSGKTVRIVGKANQVEGETAKVDSNGSFDMHLTVDNTLEPNHFYEFVVSVKPDSSVQLLTCVDFGTDIDMEVYQKLVLFSHKYNSLFFE 377BCF913652F1AE sfr1_schpo Swi5-dependent recombination DNA repair protein 1 sfr1 dds20 SPBC28F2.07 DNA repair protein dds20 Meiotically up-regulated gene 13 protein mug13 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSQTINSELNENATSQCKEDLKVSLSESDLRDSQGQLGIENPPKCNNSGNHSDNLGFIEQSETVHPENEKALTPDLRDTKIHTSLPITTPFSKKRAREAKNILLKPFKSPLRQTASPQVADTNLKPSLAVTNLNSDETNTSSEPVTSPLRTTPNSIKRQKRLFKSPISNCLNPKSDPEITQLLSRRLKLEKEVRNLQEQLITAETARKVEAKNEDKDLQTLIQKWKNAAQQAAEVLFKPMAERIRLAGGVTQSFRIEEGENKGQIQEVRTEFTMSMFLNQFGVPVHLMSFDEENGDWKS EFE91ABDE965C82D EFE91ABDE965C82D swi5_schpo Mating-type switching protein swi5 swi5 SPBC409.03 DNA repair protein swi5 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEKSQLESRVHLLEQQKEQLESSLQDALAKLKNRDAKQTVQKHIDLLHTYNEIRDIALGMIGKVAEHEKCTSVELFDRFGVNGSE DAA84500D8A84B71 DAA84500D8A84B71 rad51_schpo DNA repair protein rhp51 rhp51 rad51 SPAC644.14c RAD51 homolog protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MADTEVEMQVSAADTNNNENGQAQSNYEYDVNVQDEEDEAAAGPMPLQMLEGNGITASDIKKIHEAGYYTVESIAYTPKRQLLLIKGISEAKADKLLGEASKLVPMGFTTATEYHIRRSELITITTGSKQLDTLLQGGVETGSITELFGEFRTGKSQICHTLAVTCQLPIDMGGGEGKCLYIDTEGTFRPVRLLAVADRYGLNGEEVLDNVAYARAYNADHQLELLQQAANMMSESRFSLLVVDSCTALYRTDFSGRGELSARQMHLARFMRTLQRLADEFGIAVVITNQVVAQVDGISFNPDPKKPIGGNILAHSSTTRLSLRKGRGEQRICKIYDSPCLPESEAIFAINSDGVGDPKEIIAPV 9F26EB9FA4F3C2BA 9F26EB9FA4F3C2BA rfa2_schpo Replication factor A protein 2 ssb2 Single-stranded DNA-binding protein P30 subunit SPCC1753.01c SPCC584.06c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAYDAFGKPGYGPDFNSAFSPGMGGGAGFNEYDQSSQPSVDRQQGAGNKLRPVTIKQILNASQVHADAEFKIDGVEVGQVTFVGVLRNIHAQTTNTTYQIEDGTGMIEVRHWEHIDALSELATDTYVRVYGNIKIFSGKIYIASQYIRTIKDHNEVHFHFLEAIAVHLHFTQKANAVNGANAPGYGTSNALGYNNISSNGAANSLEQKLAEYSLTPAQMTVMQAIHSAPETNEGVHVRQLAQSVGPGIDLTAVTDFLQQEGIIYTTIDENHFKSVLQDQ C43C94A732E2EA9B rfa1_schpo Replication factor A protein 1 ssb1 rad11 rpa1 SPBC660.13c Single-stranded DNA-binding protein p68 subunit protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAERLSVGALRIINTSDASSFPPNPILQVLTVKELNSNPTSGAPKRYRVVLSDSINYAQSMLSTQLNHLVAENKLQKGAFVQLTQFTVNVMKERKILIVLGLNVLTELGVMDKIGNPAGLETVDALRQQQNEQNNASAPRTGISTSTNSFYGNNAAATAPAPPPMMKKPAAPNSLSTIIYPIEGLSPYQNKWTIRARVTNKSEVKHWHNQRGEGKLFSVNLLDESGEIRATGFNDQVDAFYDILQEGSVYYISRCRVNIAKKQYTNVQNEYELMFERDTEIRKAEDQTAVPVAKFSFVSLQEVGDVAKDAVIDVIGVLQNVGPVQQITSRATSRGFDKRDITIVDQTGYEMRVTLWGKTAIEFSVSEESILAFKGVKVNDFQGRSLSMLTSSTMSVDPDIQESHLLKGWYDGQGRGQEFAKHSVISSTLSTTGRSAERKNIAEVQAEHLGMSETPDYFSLKGTIVYIRKKNVSYPACPAADCNKKVFDQGGSWRCEKCNKEYDAPQYRYIITIAVGDHTGQLWLNVFDDVGKLIMHKTADELNDLQENDENAFMNCMAEACYMPYIFQCRAKQDNFKGEMRVRYTVMSINQMDWKEESKRLINFIESAQ 5F2E77A0E12022EA 5F2E77A0E12022EA dmc1_schpo Meiotic recombination protein dmc1 dmc1 dmp1 SPAC8E11.03c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEEFAEGNDDEQMIFSDIEDLTAHGIGMTDIIKLKQAGVCTVQGVHMSTKRFLLKIKGFSEAKVDKLKEAASKMCPANFSTAMEISQNRKKVWSISTGSEALNGILGGGIQSMSITEVFGEFRCGKTQMSHTLCVTAQLPRDMGGAEGKVAFIDTEGTFRPDRIKAIAERFGVDADQAMENIIVSRAYNSEQQMEYITKLGTIFAEDGQYRLLIVDSIMALFRVDYSGRGELSERQQKLNIMLARLNHISEEFNVAVFVTNQVQADPGAAMMFASNDRKPVGGHVMAHASATRLLLRKGRGEERVAKLNDSPDMPEAECSYVITPGGIADVS 86B73EAA491F7B02 86B73EAA491F7B02 sfr1-swi5-1 9 15 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 16 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction sfr1-swi5-2 7 15 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 16 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction sfr1-swi5-3 13 15 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 16 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction swi5-sfr1-4 6 15 unspecified role unspecified role prey prey ecolx Escherichia coli 16 unspecified role unspecified role bait bait ecolx Escherichia coli direct interaction direct interaction sfr1-swi5-4 4 15 unspecified role unspecified role bait bait ecolx Escherichia coli 16 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction rad51-sfr1-1 8 17 unspecified role unspecified role bait bait spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role prey prey ecolx Escherichia coli 16 unspecified role unspecified role prey prey ecolx Escherichia coli association association sfr1-rad51-1 2 17 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role bait bait ecolx Escherichia coli 16 unspecified role unspecified role prey prey ecolx Escherichia coli association association swi5-rad51-1 10 17 unspecified role unspecified role prey prey spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 15 unspecified role unspecified role prey prey ecolx Escherichia coli 16 unspecified role unspecified role bait bait ecolx Escherichia coli association association dmc1-sfr1-1 12 20 unspecified role unspecified role bait bait ecolx Escherichia coli 15 unspecified role unspecified role prey prey ecolx Escherichia coli 16 unspecified role unspecified role prey prey ecolx Escherichia coli association association sfr1-dmc1-1 5 20 unspecified role unspecified role prey prey ecolx Escherichia coli 15 unspecified role unspecified role bait bait ecolx Escherichia coli 16 unspecified role unspecified role prey prey ecolx Escherichia coli association association swi5-dmc1-1 1 20 unspecified role unspecified role prey prey ecolx Escherichia coli 15 unspecified role unspecified role prey prey ecolx Escherichia coli 16 unspecified role unspecified role bait bait ecolx Escherichia coli association association rpa1-rpa2-5 11 19 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 14 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 18 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association rpa1-rpa2-6 3 19 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 14 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 18 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association