IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Molecular analysis of NTB-A signaling: a role for EAT-2 in NTB-A-mediated activation of human NK cells. Molecular analysis of NTB-A signaling: a role for EAT-2 in NTB-A-mediated activation of human NK cells. Journal of immunology (Baltimore, Md. : 1950) 2006 imex curation Eissmann P., Watzl C. carsten.watzl@urz.uni-heidelberg.de 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions human-nk_cells human-Natural Killer cells Human nk_cells Natural killer cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Eissmann P., Watzl C. Untreated IL-2-activated human NK cells, or a mix of primary human IL-2 activated NK cells with 721.221 cells (- which do not express either SAP or EAT-2.) carsten.watzl@urz.uni-heidelberg.de Accepted 2017-JUN-30 AT 09:15 BST AT 09:15 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2006 imex curation added back Fig 7A Molecular analysis of NTB-A signaling: a role for EAT-2 in NTB-A-mediated activation of human NK cells. Molecular analysis of NTB-A signaling: a role for EAT-2 in NTB-A-mediated activation of human NK cells. Journal of immunology (Baltimore, Md. : 1950) 2006 imex curation Eissmann P., Watzl C. carsten.watzl@urz.uni-heidelberg.de 14-Jul-2017: Contacted by IntAct-Help. Only protein-protein interactions human-nkl Homo sapiens nkl nkl anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Eissmann P., Watzl C. The residue mapping of the Y2F and Y13F cytoplasmic tail mutants was deduced from the distance apart of the adenine nucleotide residues as stated in the methods;Y1 (818), Y2 (851), Y3 (923). I divided the nuc. apart distance by 3 to get the distance apart of aa residues. (why cannot they just have given the residue numbering??) NTB-A-negative and -positive NKL lines were generated. carsten.watzl@urz.uni-heidelberg.de Accepted 2017-JUN-30 AT 09:15 BST AT 09:15 BST by ORCHARD Journal of immunology (Baltimore, Md. : 1950) 2006 imex curation added back Fig 7A sh21a_human SH2 domain-containing protein 1A SH2D1A DSHP SAP Signaling lymphocytic activation molecule-associated protein T-cell signal transduction molecule SAP Duncan disease SH2-protein protein protein human Homo sapiens Human MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP mint Inhibitor of the SLAM self-association. Acts by blocking recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to a docking site in the slam cytoplasmic region Defects in SH2D1A are a cause of lymphoproliferative syndrome X-linked type 1 (XLP1) [MIM:308240]; also known as X-linked lymphoproliferative disease (XLPD) or Duncan disease. XLP is a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus (EBV). Symptoms include severe or fatal mononucleosis, acquired hypogammaglobulinemia, pancytopenia and malignant lymphoma 90234E7A6614EE3D cd244_human Natural killer cell receptor 2B4 NK cell type I receptor protein 2B4 NK cell activation-inducing ligand CD244 2B4 SLAM family member 4 Signaling lymphocytic activation molecule 4 protein protein human Homo sapiens Human MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSRKELENFDVYS DIP protein Q9BZW8 original sequence version: 134 DIP protein Q9BZW8 original sequence version: 125 959FF8DBB0BACC87 sh21b_human SH2 domain-containing protein 1B SH2D1B EAT2 EWS/FLI1-activated transcript 2 protein protein human Homo sapiens Human MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKHGYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETFVNSNSDYVDVLP BC9FEA398B6B27DE slaf6_human SLAM family member 6 KALI SLAMF6 Activating NK receptor NK-T-B-antigen UNQ6123/PRO20080 protein protein human Homo sapiens Human MLWLFQSLLFVFCFGPGNVVSQSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKMILFMVSGICIVFGFIILLLLVLRKRRDSLSLSTQRTQGPAESARNLEYVSVSPTNNTVYASVTHSNRETEIWTPRENDTITIYSTINHSKESKPTFSRATALDNVV 46D8141A0D198091 slamf6-sh2d1a-2 1 3 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey association association 3A, 4A/B CHEBI:78332 -Src kinase inhibitor, PP1 sh2d1a-sh2d1b-1 1 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association 5A IL-2-activated primary human NK cells. A very weak association with CD244 was detected. sh2d1a-cd244-1 2 3 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association 5C sh2d1a-sh2d1b-2 2 6 unspecified role unspecified role bait bait Q96DU3:p.[Tyr274Phe;Tyr309Phe] mutation mutation certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 14:48:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr274phe,tyr309phe' Tue Jun 30 17:38:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr274Phe;Tyr309Phe]' 5 unspecified role unspecified role prey prey physical association physical association 7Ai The Y13F mutant, only containing functional Y2, coimmunoprecipitated EAT-2, but not SAP. slamf6-sh2d1a-3 2 3 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait Q96DU3:p.Tyr285Phe mutation mutation certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 18:36:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr285phe' Tue Jun 30 17:46:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr285Phe' physical association physical association 7Aii When the second tyrosine was mutated (Y2F), the association of EAT-2 with NTB-A was lost, while SAP still associated. sh2d1a-sh2d1b-3 2 3 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey association association 7A