DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The structure of H5N1 avian influenza neuraminidase suggests new opportunities for drug design. The structure of H5N1 avian influenza neuraminidase suggests new opportunities for drug design. Nature 2006 imex curation Russell RJ., Haire LF., Stevens DJ., Collins PJ., Lin YP., Blackburn GM., Hay AJ., Gamblin SJ., Skehel JJ. Only protein-protein interactions chick Gallus gallus (Chicken) Chicken x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Russell RJ., Haire LF., Stevens DJ., Collins PJ., Lin YP., Blackburn GM., Hay AJ., Gamblin SJ., Skehel JJ. DIP original experiment: DIP-254013X Nature 2006 IMEx The structure of H5N1 avian influenza neuraminidase suggests new opportunities for drug design. The structure of H5N1 avian influenza neuraminidase suggests new opportunities for drug design. The structure of H5N1 avian influenza neuraminidase suggests new opportunities for drug design. Nature 2006 imex curation Russell RJ., Haire LF., Stevens DJ., Collins PJ., Lin YP., Blackburn GM., Hay AJ., Gamblin SJ., Skehel JJ. Only protein-protein interactions chick Gallus gallus (Chicken) Chicken x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Russell RJ., Haire LF., Stevens DJ., Collins PJ., Lin YP., Blackburn GM., Hay AJ., Gamblin SJ., Skehel JJ. DIP original experiment: DIP-254014X Nature 2006 IMEx The structure of H5N1 avian influenza neuraminidase suggests new opportunities for drug design. The structure of H5N1 avian influenza neuraminidase suggests new opportunities for drug design. The structure of H5N1 avian influenza neuraminidase suggests new opportunities for drug design. Nature 2006 imex curation Russell RJ., Haire LF., Stevens DJ., Collins PJ., Lin YP., Blackburn GM., Hay AJ., Gamblin SJ., Skehel JJ. Only protein-protein interactions human Homo sapiens Human x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Russell RJ., Haire LF., Stevens DJ., Collins PJ., Lin YP., Blackburn GM., Hay AJ., Gamblin SJ., Skehel JJ. DIP original experiment: DIP-254012X Nature 2006 IMEx The structure of H5N1 avian influenza neuraminidase suggests new opportunities for drug design. q6dpl2_9infa Neuraminidase NA protein protein influenza a virus (a/viet nam/1203/2004(h5n1)) Influenza A virus (A/Viet Nam/1203/2004(H5N1)) MNPNQKIITIGSICMVTGIVSLMLQIGNMISIWVSHSIHTGNQHQSEPISNTNFLTEKAVASVKLAGNSSLCPINGWAVYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPHRTLMSCPVGEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASHKIFKMEKGKVVKSVELDAPNYHYEECSCYPNAGEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIGRTKSTNSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKESTIWTSGSSISFCGVNSDTVGWSWPDGAELPFTIDK DIP protein Q6DPL2 original sequence version: 71 DIP protein Q6DPL2 original sequence version: 65 q6xv46_9infa Neuraminidase NA protein protein influenza a virus (a/mink/sweden/e12665/84(h10n4)) Influenza A virus (A/mink/Sweden/E12665/84(H10N4)) MNPNQKIITIGSVSIVLTTIGLLLQITSLCSIWFSHYNQVTQTNEQPCSNNTTNYYNETFVNVTNVQNNYTTITDPSTSQVIHYSSGKDLCPVKGWAPLSKDNGIRIGSRGEVFVIREPFISCSINECRTFFLTQGALLNDKHSNGTVKDRSPFRTLMSCPIGVAPSPSNSRFESVAWSATACSDGPGWLTIGITGPDATAVAVLKYNGIITDTLKSWKGNIMRTQESECVCQDEFCYTLITDGPSDAQAFYKILKIKKGKIVSVKDVDAPGFHFEECSCYPSGENVECVCRDNWRGSNRPWIRFNSDLDYQIGYVCSGVFGDNPRPMDSTGSCNSPINNGKGRYGVKGFSFRYGDGVWIGRTKSLESRSGFEMVWDANGWVSTDKDSNGVQDIIDNDNWSGYSGSFSIRGETTGRNCTVPCFWVEMIRGQPKEKTIWTSGSSIAFCGVNSDTTGWSWPDGALLPFDIDK DIP protein Q6XV46 original sequence version: 56 nram_i63a3 Neuraminidase NA protein protein i63a3 Influenza A virus (strain A/Duck/Ukraine/1/1963 H3N8) MNPNQKIITIGSISLGLVVFNVLLHVVSIIVTVLVLGKGGNNGICNETVVREYNETVRIEKVTQWHNTNVVEYVPYWNGGTYMNNTEAICDAKGFAPFSKDNGIRIGSRGHIFVIREPFVSCSPIECRTFFLTQGSLLNDKHSNGTVKDRSPFRTLMSVEVGQSPNVYQARFEAVAWSATACHDGKKWMTVGVTGPDSKAVAVIHYGGVPTDVVNSWAGDILRTQESSCTCIQGDCYWVMTDGPANRQAQYRIYKANQGRIIGQTDISFNGGHIEECSCYPNDGKVECVCRDGWTGTNRPVLVISPDLSYRVGYLCAGIPSDTPRGEDTQFTGSCTSPMGNQGYGVKGFGFRQGTDVWMGRTISRTSRSGFEILRIKNGWTQTSKEQIRKQVVVDNLNWSGYSGSFTLPVELSGKDCLVPCFWVEMIRGKPEEKTIWTSSSSIVMCGVDYEVADWSWHDGAILPFDIDKM DIP protein Q07599 original sequence version: 90 na-1 3 4 unspecified role unspecified role unspecified role unspecified role Region 63-449 Region 63-449 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human direct interaction direct interaction na-2 1 5 unspecified role unspecified role unspecified role unspecified role Region 81-470 Region 81-470 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chick Gallus gallus (Chicken) Chicken direct interaction direct interaction na-3 2 6 unspecified role unspecified role unspecified role unspecified role Region 81-470 Region 81-470 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chick Gallus gallus (Chicken) Chicken direct interaction direct interaction