DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Prokaryotic type II and type III pantothenate kinases: The same monomer fold creates dimers with distinct catalytic properties. Prokaryotic type II and type III pantothenate kinases: The same monomer fold creates dimers with distinct catalytic properties. Structure (London, England : 1993) 2006 imex curation Hong BS., Yun MK., Zhang YM., Chohnan S., Rock CO., White SW., Jackowski S., Park HW., Leonardi R. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hong BS., Yun MK., Zhang YM., Chohnan S., Rock CO., White SW., Jackowski S., Park HW., Leonardi R. DIP original experiment: DIP-66369X Structure (London, England : 1993) 2006 IMEx Prokaryotic type II and type III pantothenate kinases: The same monomer fold creates dimers with distinct catalytic properties. Prokaryotic type II and type III pantothenate kinases: The same monomer fold creates dimers with distinct catalytic properties. Prokaryotic type II and type III pantothenate kinases: The same monomer fold creates dimers with distinct catalytic properties. Structure (London, England : 1993) 2006 imex curation Hong BS., Yun MK., Zhang YM., Chohnan S., Rock CO., White SW., Jackowski S., Park HW., Leonardi R. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hong BS., Yun MK., Zhang YM., Chohnan S., Rock CO., White SW., Jackowski S., Park HW., Leonardi R. DIP original experiment: DIP-66368X Structure (London, England : 1993) 2006 IMEx Prokaryotic type II and type III pantothenate kinases: The same monomer fold creates dimers with distinct catalytic properties. coax_pseae Type III pantothenate kinase coaX PanK-III Pantothenic acid kinase coaA PA4279 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MILELDCGNSLIKWRVIEGAARSVAGGLAESDDALVEQLTSQQALPVRACRLVSVRSEQETSQLVARLEQLFPVSALVASSGKQLAGVRNGYLDYQRLGLDRWLALVAAHHLAKKACLVIDLGTAVTSDLVAADGVHLGGYICPGMTLMRSQLRTHTRRIRYDDAEARRALASLQPGQATAEAVERGCLLMLRGFVREQYAMACELLGPDCEIFLTGGDAELVRDELAGARIMPDLVFVGLALACPIE 609D37480899DA3B coaw_staa3 Type II pantothenate kinase coaW coaA SAUSA300_2084 PanK-II Pantothenic acid kinase protein protein staa3 Staphylococcus aureus (strain USA300) MKVGIDAGGTLIKIVQEQDNQRTFKTELTKNIDQVVEWLNQQQIEKLCLTGGNAGVIAENINIPAQIFVEFDAASQGLGILLKEQGHDLADYIFANVGTGTSLHYFDGQSQRRVGGIGTGGGMIQGLGYLLSQITDYKQLTDMAQHGDRNTIDLKVRHIYKDTEPPIPGDLTAANFGHVLHHLDADFTPSNKLAAVIGVVGEVVTTMAITVAREFKTENIVYIGSSFHNNALLRKVVEDYTVLRGCKPYYVENGAFSGAIGALYLEK DIP protein Q2FEZ8 original sequence version: 9 coaw-1 2 4 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction pacoaa-1 1 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction