DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structural organization of the 19S proteasome lid: insights from MS of intact complexes. Structural organization of the 19S proteasome lid: insights from MS of intact complexes. PLoS biology 2006 imex curation Sharon M., Taverner T., Ambroggio XI., Deshaies RJ., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Sharon M., Taverner T., Ambroggio XI., Deshaies RJ., Robinson CV. DIP original experiment: DIP-66477X PLoS biology 2006 IMEx Structural organization of the 19S proteasome lid: insights from MS of intact complexes. Structural organization of the 19S proteasome lid: insights from MS of intact complexes. Structural organization of the 19S proteasome lid: insights from MS of intact complexes. PLoS biology 2006 imex curation Sharon M., Taverner T., Ambroggio XI., Deshaies RJ., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Sharon M., Taverner T., Ambroggio XI., Deshaies RJ., Robinson CV. DIP original experiment: DIP-66474X PLoS biology 2006 IMEx Structural organization of the 19S proteasome lid: insights from MS of intact complexes. Structural organization of the 19S proteasome lid: insights from MS of intact complexes. Structural organization of the 19S proteasome lid: insights from MS of intact complexes. PLoS biology 2006 imex curation Sharon M., Taverner T., Ambroggio XI., Deshaies RJ., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Sharon M., Taverner T., Ambroggio XI., Deshaies RJ., Robinson CV. DIP original experiment: DIP-66479X PLoS biology 2006 IMEx Structural organization of the 19S proteasome lid: insights from MS of intact complexes. Structural organization of the 19S proteasome lid: insights from MS of intact complexes. Structural organization of the 19S proteasome lid: insights from MS of intact complexes. PLoS biology 2006 imex curation Sharon M., Taverner T., Ambroggio XI., Deshaies RJ., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Sharon M., Taverner T., Ambroggio XI., Deshaies RJ., Robinson CV. DIP original experiment: DIP-66475X PLoS biology 2006 IMEx Structural organization of the 19S proteasome lid: insights from MS of intact complexes. Structural organization of the 19S proteasome lid: insights from MS of intact complexes. Structural organization of the 19S proteasome lid: insights from MS of intact complexes. PLoS biology 2006 imex curation Sharon M., Taverner T., Ambroggio XI., Deshaies RJ., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Sharon M., Taverner T., Ambroggio XI., Deshaies RJ., Robinson CV. DIP original experiment: DIP-66478X PLoS biology 2006 IMEx Structural organization of the 19S proteasome lid: insights from MS of intact complexes. Structural organization of the 19S proteasome lid: insights from MS of intact complexes. Structural organization of the 19S proteasome lid: insights from MS of intact complexes. PLoS biology 2006 imex curation Sharon M., Taverner T., Ambroggio XI., Deshaies RJ., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Sharon M., Taverner T., Ambroggio XI., Deshaies RJ., Robinson CV. DIP original experiment: DIP-66480X PLoS biology 2006 IMEx Structural organization of the 19S proteasome lid: insights from MS of intact complexes. Structural organization of the 19S proteasome lid: insights from MS of intact complexes. Structural organization of the 19S proteasome lid: insights from MS of intact complexes. PLoS biology 2006 imex curation Sharon M., Taverner T., Ambroggio XI., Deshaies RJ., Robinson CV. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ms of complexes mass spectrometry studies of complexes ms of complexes ms participant Identification by mass spectrometry ms participant Sharon M., Taverner T., Ambroggio XI., Deshaies RJ., Robinson CV. DIP original experiment: DIP-66476X PLoS biology 2006 IMEx Structural organization of the 19S proteasome lid: insights from MS of intact complexes. rpn8_yeast 26S proteasome regulatory subunit RPN8 RPN8 O5360 YOR261C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLQHEKVTIAPLVLLSALDHYERTQTKENKRCVGVILGDANSSTIRVTNSFALPFEEDEKNSDVWFLDHNYIENMNEMCKKINAKEKLIGWYHSGPKLRASDLKINELFKKYTQNNPLLLIVDVKQQGVGLPTDAYVAIEQVKDDGTSTEKTFLHLPCTIEAEEAEEIGVEHLLRDVRDQAAGGLSIRLTNQLKSLKGLQSKLKDVVEYLDKVINKELPINHTILGKLQDVFNLLPNLGTPDDDEIDVENHDRINISNNLQKALTVKTNDELMVIYISNLVRSIIAFDDLIENKIQNKKIQEQRVKDKQSKVSDDSESESGDKEATAPLIQRKNKKN 6EE6009545A3D0EF 6EE6009545A3D0EF rpn5_yeast 26S proteasome regulatory subunit RPN5 RPN5 NAS5 YDL147W D1572 Proteasome non-ATPase subunit 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRDAPIKADKDYSQILKEEFPKIDSLAQNDCNSALDQLLVLEKKTRQASDLASSKEVLAKIVDLLASRNKWDDLNEQLTLLSKKHGQLKLSIQYMIQKVMEYLKSSKSLDLNTRISVIETIRVVTENKIFVEVERARVTKDLVEIKKEEGKIDEAADILCELQVETYGSMEMSEKIQFILEQMELSILKGDYSQATVLSRKILKKTFKNPKYESLKLEYYNLLVKISLHKREYLEVAQYLQEIYQTDAIKSDEAKWKPVLSHIVYFLVLSPYGNLQNDLIHKIQNDNNLKKLESQESLVKLFTTNELMRWPIVQKTYEPVLNEDDLAFGGEANKHHWEDLQKRVIEHNLRVISEYYSRITLLRLNELLDLTESQTETYISDLVNQGIIYAKVNRPAKIVNFEKPKNSSQLLNEWSHNVDELLEHIETIGHLITKEEIMHGLQAK E5DC7F8E6AE27736 E5DC7F8E6AE27736 rpn7_yeast 26S proteasome regulatory subunit RPN7 RPN7 P8283.8 YPR108W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVDVEEKSQEVEYVDPTVNRVPNYEVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAISTGAKIDVMLTIARLGFFYNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDSLATFTSIELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAAVRLTGSDRV B21B66CD818E636D B21B66CD818E636D sem1_yeast 26S proteasome complex subunit SEM1 SEM1 DSH1 YDR363W-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTDVAAAQAQSKIDLTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIKSNAVTQTNIWEENWDDVEVDDDFTNELKAELDRYKRENQ B66B578ABB01E672 B66B578ABB01E672 rpn6_yeast 26S proteasome regulatory subunit RPN6 RPN6 NAS4 YDL097C D2381 Proteasome non-ATPase subunit 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLPGSKLEEARRLVNEKQYNEAEQVYLSLLDKDSSQSSAAAGASVDDKRRNEQETSILELGQLYVTMGAKDKLREFIPHSTEYMMQFAKSKTVKVLKTLIEKFEQVPDSLDDQIFVCEKSIEFAKREKRVFLKHSLSIKLATLHYQKKQYKDSLALINDLLREFKKLDDKPSLVDVHLLESKVYHKLRNLAKSKASLTAARTAANSIYCPTQTVAELDLMSGILHCEDKDYKTAFSYFFESFESYHNLTTHNSYEKACQVLKYMLLSKIMLNLIDDVKNILNAKYTKETYQSRGIDAMKAVAEAYNNRSLLDFNTALKQYEKELMGDELTRSHFNALYDTLLESNLCKIIEPFECVEISHISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYVYETPNQDATYDSALELVGQLNKVVDQLFEKASVLY A8B1F7E6F73A4024 A8B1F7E6F73A4024 rpn11_yeast Ubiquitin carboxyl-terminal hydrolase RPN11 YFR004W RPN11 MPR1 Protein MPR1 26S proteasome regulatory subunit RPN11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MERLQRLMMNSKVGSADTGRDDTKETVYISSIALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLKQTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLIDTGALINNLEPRQTTSNTGLLNKANIQALIHGLNRHYYSLNIDYHKTAKETKMLMNLHKEQWQSGLKMYDYEEKEESNLAATKSMVKIAEQYSKRIEEEKELTEEELKTRYVGRQDPKKHLSETADETLENNIVSVLTAGVNSVAIK 9DDE8BD74890894D 9DDE8BD74890894D rpn9_yeast 26S proteasome regulatory subunit RPN9 RPN9 NAS7 YDR427W D9461.14 Proteasome non-ATPase subunit 7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MFNNHEIDTILSTLRMEADPSLHPLFEQFEKFYEEKLWFQLSESLTKFFDDAKSTPLRLRLYDNFVSKFYDKINQLSVVKYLLASLKDSKDFDESLKYLDDLKAQFQELDSKKQRNNGSKDHGDGILLIDSEIARTYLLKNDLVKARDLLDDLEKTLDKKDSIPLRITNSFYSTNSQYFKFKNDFNSFYYTSLLYLSTLEPSTSITLAERQQLAYDLSISALLGDKIYNFGELLHHPIMETIVNDSNYDWLFQLLNALTVGDFDKFDSLIKVQISKIPILAQHESFLRQKICLMTLIETVFVKNIRMLSFEDISKATHLPKDNVEHLVMRAISLGLLKGSIDQVNELVTISWVQPRIISGDQITKMKDRLVEWNDQVEKLGKKMEARGQSIWV 540F7DF8C23469A1 540F7DF8C23469A1 rpn3_yeast 26S proteasome regulatory subunit RPN3 RPN3 SUN2 YER021W protein protein yeast Saccharomyces cerevisiae Baker's yeast MASTAVMMDVDSSGVNDLHHSEKKYAEEDQVQELLKVLNEISKTTLTLDPRYIWRSLKDLSSLRNQELLNAETLCFTVNVLYPDSSSFKKNLLKFITSNHKSSVPGSAELRNSYPASFYSVNTEKKTIEVTAEINCFMHLLVQLFLWDSKELEQLVEFNRKVVIPNLLCYYNLRSLNLINAKLWFYIYLSHETLARSSEEINSDNQNIILRSTMMKFLKIASLKHDNETKAMLINLILRDFLNNGEVDSASDFISKLEYPHTDVSSSLEARYFFYLSKINAIQLDYSTANEYIIAAIRKAPHNSKSLGFLQQSNKLHCCIQLLMGDIPELSFFHQSNMQKSLLPYYHLTKAVKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISLTYKKISLRDICLKLNLDSEQTVEYMVSRAIRDGVIEAKINHEDGFIETTELLNIYDSEDPQQVFDERIKFANQLHDEYLVSMRYPEDKKTQQNEKSENGENDDDTLDGDLMDDMSDISDLDDLGFL B08B58663DDA85DC B08B58663DDA85DC rpn7-sem1-1 2 11 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpn3-sem1-1 4 15 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpn3-rpn5-5 7 9 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction rpn3-rpn5-6 1 8 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpn3-rpn5-7 5 14 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpn5-rpn6-13 3 12 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association rpn11-rpn3-5 6 15 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 14 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association