DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255211X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255221X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255202X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255214X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255217X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255207X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255209X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255199X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255203X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255213X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255200X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255219X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255212X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255208X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255201X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255218X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255206X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255205X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255204X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255198X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255220X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255210X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255215X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. Nature 2006 imex curation Pan X., Eathiraj S., Munson M., Lambright DG. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Pan X., Eathiraj S., Munson M., Lambright DG. DIP original experiment: DIP-255216X Nature 2006 IMEx TBC-domain GAPs for Rab GTPases accelerate GTP hydrolysis by a dual-finger mechanism. rab38_human Ras-related protein Rab-38 RAB38 Melanoma antigen NY-MEL-1 protein protein human Homo sapiens Human MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKVLHWDPETVVRLQLWDIAGQERFGNMTRVYYREAMGAFIVFDVTRPATFEAVAKWKNDLDSKLSLPNGKPVSVVLLANKCDQGKDVLMNNGLKMDQFCKEHGFVGWFETSAKENINIDEASRCLVKHILANECDLMESIEPDVVKPHLTSTKVASCSGCAKS DIP protein P57729 original sequence version: 119 DIP protein P57729 original sequence version: 140 0D16B42A1B237539 rab12_rat Ras-related protein Rab-12 Rab12 protein protein rat Rattus norvegicus (Rat) Rat MDPSAALHRRPAGGGLGAVSPALSGGQARRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREISRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDVLRSELSNSILSLQPEPEIPPELPPPRPHVRCC DIP protein P35284 original sequence version: 101 237A9421E6784584 gyp7_yeast GTPase-activating protein GYP7 YDL234C GYP7 GAP for YPT7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKILFCKSKVFLHPTSDARDNIAGFLLLTLEANKLSHQAILQYIPESGLSTLEISKLLKHEAKVGTCPTSTPFVIENSINFSNLVNTSLGQAFEISLSQIYCIQFRPPSPNGWYVGSLVIYPLTEQFTGFQPPVLFFHDQLCPSTTDKLKRLRKSMNPFDDSDELYWGGVDLRNKINELMELKKSNLEPEFWLVNPSLNDLRNFVSKDLLESYNNSKKDTTELATAGVKLNEKFQEWKWNVMSKIADVTTKSTNFIDSWLTNNSPIQKSQIDNEYLQKLLNNEKVKQIEQDYDSARVYLANWSLGVKQEAERYQKQNKLFDSYRNNIFNDLNLTDELSDTEINNALQRQFPLTEAKWNSLWDENDGRLRVTVNEVKDFIFHGGLENDSLRGKVWGFLLEIYPWDSSQDERVQIDQTLAAEYDQLKLTWSKDFLQFDDEDEEEYWNDQLFRISKDVRRCDRNLEIFQYNTIDGLPPPPQQLPANENNSTSPESANDESDDADDGVRNPHLIHLQNILITYNVYNTNLGYVQGMTDLLSPIYVIMKEEWKTFWCFTHFMDIMERNFLRDQSGIHEQMLTLVELVQLMLPELSEHLNKCDSGNLFFCFRMLLVWFKREFEMEDIMHIWENFWTFYYSSQFQLFFMLAILQKNSQAILQHLNQFDQILKFFNELNGKLDWNDLMVRAELLFKKFEKMMHVMERDLQNVSSSSSSSSTGVLPCQSERLTLLLSKKPIIRHEGQRSKNSVK 10F0F2B11A9993A6 10F0F2B11A9993A6 rab35_mouse Ras-related protein Rab-35 Rab35 protein protein mouse Mus musculus Mouse MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC DIP protein Q6PHN9 original sequence version: 90 31EB15D6D42E076E rb33b_mouse Ras-related protein Rab-33B Rab33b protein protein mouse Mus musculus Mouse MTSEMESSLEVSFSSSCAVSGASGCLPPARSRIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVDIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPAWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLMLSQLPDNRISLKPETKPAVTCWC DIP protein O35963 original sequence version: 119 EE2B3E482FC4365A rab7a_mouse Ras-related protein Rab-7a Rab7a Rab7 protein protein mouse Mus musculus Mouse MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC DIP protein P51150 original sequence version: 121 mint Involved in late endocytic transport. Contributes to the maturation of phagosomes (acidification) A2AF33B16A672971 rab3a_mouse Ras-related protein Rab-3A Rab3a protein protein mouse Mus musculus Mouse MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC DIP protein P63011 original sequence version: 100 DIP protein P63011 original sequence version: 53 1A3E9F8C9D09EB40 rab14_human Ras-related protein Rab-14 RAB14 protein protein human Homo sapiens Human MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC DIP protein P61106 original sequence version: 114 BC8A8B98FB9944AC rab5c_mouse Ras-related protein Rab-5C Rab5c protein protein mouse Mus musculus Mouse MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNAAGAPGRTRGVDLQESNPASRSQCCSN DIP protein P35278 original sequence version: 117 AA5658239D8D77ED rab7l_rat Ras-related protein Rab-7L1 Rab29 Rab-7-like protein 1 Rab7l1 Ras-related protein Rab-29 protein protein rat Rattus norvegicus (Rat) Rat MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDSEMVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPSGEPVPCLLLANKSDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLVEKMMNNSREDIMSSSTQGNYINLQTKPSPGWTCC DIP protein Q63481 original sequence version: 84 4CFAE889718F20E5 ypt7_yeast Ypt/Rab-type GTPase YPT7 YPT7 VAM4 Vacuolar morphology protein 4 YM8270.02 YML001W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATMQVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFPFVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQNQADTEAFEDDYNDAINIRLDGENNSCSC 0E2B72BDA7F7CEE5 0E2B72BDA7F7CEE5 rb39a_human Ras-related protein Rab-39A RAB39A RAB39 protein protein human Homo sapiens Human METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFFSRLLEIEPGKRIKLQLWDTAGQERFRSITRSYYRNSVGGFLVFDITNRRSFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTILTRDIYELIKKGEICIQDGWEGVKSGFVPNTVHSSEEAVKPRKECFC DIP protein Q14964 original sequence version: 121 ABD121649354D7F5 rab30_human Ras-related protein Rab-30 RAB30 protein protein human Homo sapiens Human MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVSSPLPGEGKSISYLTCCNFN DIP protein Q15771 original sequence version: 126 935E56DBD48DD7C2 rab1b_human Ras-related protein Rab-1B RAB1B protein protein human Homo sapiens Human MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC DIP protein Q9H0U4 original sequence version: 124 DIP protein Q9H0U4 original sequence version: 114 9812FF4DAC34B2BE sec4_yeast Ras-related protein SEC4 SEC4 SRO6 Suppressor of RHO3 protein 6 YFL005W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGLRTVSASSGNGKSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDMETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSNKLVGVGNGKEGNISINSGSGNSSKSNCC 7DEDF7DCC7533BA7 7DEDF7DCC7533BA7 rab23_mouse Ras-related protein Rab-23 Rab23 Opb Protein open brain Rab-15 protein protein mouse Mus musculus Mouse MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAISSWREKVVAEVGDIPTALVQNKIDLLDDSCIKNEEAEGLAKRLKLRFYRTSVKEDLNVSEVFKYLAEKHLQKLKQQITEDPEQTHSSSNKIGVFNASVGSHLGQNSSSLNGGDVINLRPNKQRTKRTRNPFSSCSVP DIP protein P35288 original sequence version: 113 rab15_mouse Ras-related protein Rab-15 Rab15 protein protein mouse Mus musculus Mouse MAKQYDVLFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIDVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKADEEQKRQVGREQGQQLAKEYGMDFYETSACTNLNIKESFTRLTELVLQAHRKELDGLRTRASNELALAELEEDEGKPEGPANSSKTCWC DIP protein Q8K386 original sequence version: 89 E5C492846DD47F12 rab4a_human Ras-related protein Rab-4A RAB4A RAB4 protein protein human Homo sapiens Human MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC DIP protein P20338 original sequence version: 151 983D65E1162741B0 gyp1_yeast GTPase-activating protein GYP1 GYP1 YOR070C YOR29-21 GAP for YPT1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MGVRSAAKEMHERDHNSDSSSLVTSLMKSWRISSASSSKKPSLYKMNTTESTSLPSGYASSADRDRRTSDGNFEAMAKQQASTRRTSNSYSPLRYVNPTLSTASNESPRPALLLRQHHQRHHHHQQPRHSSSGSVGNNCSNSTEPNKKGDRYFKDLDEDWSAVIDDYNMPIPILTNGGFGTPVAPTRTLSRKSTSSSINSISNMGTSAVRNSSSSFTYPQLPQLQKEKTNDSKKTQLEIENERDVQELNSIIQRISKFDNILKDKTIINQQDLRQISWNGIPKIHRPVVWKLLIGYLPVNTKRQEGFLQRKRKEYRDSLKHTFSDQHSRDIPTWHQIEIDIPRTNPHIPLYQFKSVQNSLQRILYLWAIRHPASGYVQGINDLVTPFFETFLTEYLPPSQIDDVEIKDPSTYMVDEQITDLEADTFWCLTKLLEQITDNYIHGQPGILRQVKNLSQLVKRIDADLYNHFQNEHVEFIQFAFRWMNCLLMREFQMGTVIRMWDTYLSETSQEVTSSYSMSSNDIKPPVTPTEPRVASFVTPTKDFQSPTTALSNMTPNNAVEDSGKMRQSSLNEFHVFVCAAFLIKWSDQLMEMDFQETITFLQNPPTKDWTETDIEMLLSEAFIWQSLYKDATSHWL 08C1A26B6ED37E13 08C1A26B6ED37E13 rb22a_mouse Ras-related protein Rab-22A Rab22a Rab22 Rab-14 protein protein mouse Mus musculus Mouse MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVRELRQHGPPSIVVAIAGNKCDLTDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANPASGGKGFKLRRQPSEPKRSCC DIP protein P35285 original sequence version: 122 1799B676CA9091F7 rab19_mouse Ras-related protein Rab-19 Rab19 protein protein mouse Mus musculus Mouse MQFSSSSRTSDENVDYLFKVILIGDSNVGKTCVVQHFKSGVYSESQQNTIGVDFTVRSLEIDGKKVKMQVWDTAGQERFRTITQSYYRSAHAAIIAYDLTRRSTFESVPHWIHEIEKYGAANLVIMLIGNKSDLWEKRHVLFEDACTLAEKHGLLAVLETSAKESRNIDEVFVLMAKELIARNSLHLYGESAQQGLSQDSSPVLVAQVPNESTRCTC DIP protein P35294 original sequence version: 111 BAC8008B72A10036 rab13_human Ras-related protein Rab-13 RAB13 GIG4 Cell growth-inhibiting gene 4 protein protein protein human Homo sapiens Human MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKCSLG DIP protein P51153 original sequence version: 133 141621CB998178DA ypt1_yeast GTP-binding protein YPT1 YFL038C YPT1 YP2 Rab GTPase YPT1 Transport GTPase YPT1 Protein YP2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC F8C704F6BF2D227B F8C704F6BF2D227B q9np72-1 Ras-related protein Rab-18 RAB18 protein protein human Homo sapiens Human MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYCSVL DIP protein Q9NP72-1 original sequence version: 134 gyp1p-rab14-1 1 32 unspecified role unspecified role unspecified role unspecified role Region 2-215 Region 2-215 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab33b-1 20 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role unspecified role unspecified role Region 15-202 Region 15-202 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab5c-1 6 33 unspecified role unspecified role unspecified role unspecified role Region 2-216 Region 2-216 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab38-1 21 25 unspecified role unspecified role unspecified role unspecified role Region 2-211 Region 2-211 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-sec4p-1 9 39 unspecified role unspecified role unspecified role unspecified role Region 17-184 Region 17-184 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab23-1 24 40 unspecified role unspecified role unspecified role unspecified role Region 2-237 Region 2-237 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab15-1 13 41 unspecified role unspecified role unspecified role unspecified role Region 2-212 Region 2-212 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab33b-2 8 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role unspecified role unspecified role Region 15-202 Region 15-202 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab7a-1 14 30 unspecified role unspecified role unspecified role unspecified role Region 5-176 Region 5-176 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab35-1 12 28 unspecified role unspecified role unspecified role unspecified role Region 2-201 Region 2-201 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab1b-1 19 38 unspecified role unspecified role unspecified role unspecified role Region 2-208 Region 2-208 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab22a-1 23 44 unspecified role unspecified role unspecified role unspecified role Region 2-194 Region 2-194 biological feature biological feature certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab33b-3 11 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 29 unspecified role unspecified role unspecified role unspecified role Region 15-202 Region 15-202 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab18-1 10 48 unspecified role unspecified role unspecified role unspecified role Region 2-206 Region 2-206 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab12-1 7 26 unspecified role unspecified role unspecified role unspecified role Region 3-190 Region 3-190 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab3a-1 18 31 unspecified role unspecified role unspecified role unspecified role Region 18-186 Region 18-186 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab30-1 16 37 unspecified role unspecified role unspecified role unspecified role Region 2-203 Region 2-203 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region244-637 Region244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp7p-ypt7p-1 15 35 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 27 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction gyp1p-rab19-1 4 45 unspecified role unspecified role unspecified role unspecified role Region 2-217 Region 2-217 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab13-1 22 46 unspecified role unspecified role unspecified role unspecified role Region 2-203 Region 2-203 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab4a-1 17 42 unspecified role unspecified role unspecified role unspecified role Region 2-213 Region 2-213 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab39a-1 2 36 unspecified role unspecified role unspecified role unspecified role Region 2-215 Region 2-215 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-ypt1p-1 3 47 unspecified role unspecified role unspecified role unspecified role Region 4-178 Region 4-178 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction gyp1p-rab29-1 5 34 unspecified role unspecified role unspecified role unspecified role Region 2-203 Region 2-203 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 43 unspecified role unspecified role unspecified role unspecified role Region 244-637 Region 244-637 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction