DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Lumbricus erythrocruorin at 3.5 A resolution: architecture of a megadalton respiratory complex. Lumbricus erythrocruorin at 3.5 A resolution: architecture of a megadalton respiratory complex. Structure (London, England : 1993) 2006 imex curation Royer WE., Sharma H., Strand K., Knapp JE., Bhyravbhatla B. Only protein-protein interactions lumte Lumbricus terrestris Common earthworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Royer WE., Sharma H., Strand K., Knapp JE., Bhyravbhatla B. DIP original experiment: DIP-66329X Structure (London, England : 1993) 2006 IMEx Lumbricus erythrocruorin at 3.5 A resolution: architecture of a megadalton respiratory complex. Lumbricus erythrocruorin at 3.5 A resolution: architecture of a megadalton respiratory complex. Lumbricus erythrocruorin at 3.5 A resolution: architecture of a megadalton respiratory complex. Structure (London, England : 1993) 2006 imex curation Royer WE., Sharma H., Strand K., Knapp JE., Bhyravbhatla B. Only protein-protein interactions lumte Lumbricus terrestris Common earthworm x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Royer WE., Sharma H., Strand K., Knapp JE., Bhyravbhatla B. DIP original experiment: DIP-66328X Structure (London, England : 1993) 2006 IMEx Lumbricus erythrocruorin at 3.5 A resolution: architecture of a megadalton respiratory complex. glb2_lumte Extracellular globin-2 Erythrocruorin Globin AIII Globin B Globin II protein protein lumte Lumbricus terrestris Common earthworm KKQCGVLEGLKVKSEWGRAYGSGHDREAFSQAIWRATFAQVPESRSLFKRVHGDDTSHPAFIAHAERVLGGLDIAISTLDQPATLKEELDHLQVQHEGRKIPDNYFDAFKTAILHVVAAQLGRCYDREAWDACIDHIEDGIKGHH DIP protein P02218 original sequence version: 1(def) 5F62E08A11AA52A6 q9gv76_lumte protein protein lumte Lumbricus terrestris Common earthworm MWYVLGLMLVGLAAGASDPYQERRFQYLVKNQNLHIDYLAKKLHDIEEEYNKLTHDVDKKTIRQLKARISNLEEHHCDEHESECRGDVPECIHDLLFCDGEKDCRDGSDEDPETCSLNITHVGSSYTGLATWTSCEDLNPDHAIVTITAAHRKSFFPNRVWLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAPLKGQSEGYGVICDFNLGDDDHADCKIVVPSSLFVCAHFNAQRY DIP protein Q9GV76 original sequence version: 1(def) DIP protein Q9GV76 original sequence version: 17 B682164D6992F06E q2i741_lumte protein protein lumte Lumbricus terrestris Common earthworm MRGPFIGVVVVVLAAVACLLQVDAAAEEDNRARDISERIDKLTAEAFKLGRNLDARLDPIRIKKAGTLKARVDAIAEPTCDEHEYQCGGDDPQCVGDLLVCDGITDCRNGDDEKHCVLPFAKGDTFVGDQEFDHCGRFNPDHITLHIDSVTTIPFFTSHPKVTGRVDIHVDRDDDWAVSTPSFGFYSFATHRIIFRTPDKDSLYLVAQFDGYNFDRFVGETLRVGTGLPCARFIYKRQH DIP protein Q2I741 original sequence version: 4 q2i742_lumte protein protein lumte Lumbricus terrestris Common earthworm MKSLGLLLAALAVVVTLASADSPPAQSHDEIIDKLIERTNKITTSISHVESLLDDRLDPKRIRKAGSLRHRVEELEDPSCDEHEHQCGGDDPQCISKLFVCDGHNDCRNGEDEKDCTLPTKAGDKFIGDVVFDHCTKRRPEHMTLAFESSSIAAFFTPIADLHVHIEIESETDEDESEVSMPADGEYSFADHRLTIHPPEEDGLGLVGEFDGYNFDRFVGHIVHELSEEVCAEFIFHRKK DIP protein Q2I742 original sequence version: 5 A40EE0F41C57EC98 glb4_lumte Extracellular globin-4 Erythrocruorin Globin A Globin IV protein protein lumte Lumbricus terrestris Common earthworm ADDEDCCSYEDRREIRHIWDDVWSSSFTDRRVAIVRAVFDDLFKHYPTSKALFERVKIDEPESGEFKSHLVRVANGLDLLINLLDDTLVLQSHLGHLADQHIQRKGVTKEYFRGIGEAFARVLPQVLSCFNVDAWNRCFHRLVARIAKDLP DIP protein P13579 original sequence version: 46 4A2C7421F0DCBC2F q2i743_lumte protein protein lumte Lumbricus terrestris Common earthworm MLRLLLLSALSGLILADHHQPSGGGGGSYGGGGGGGGPFGRLFSDQLDPRLGANAFLIIRLDRIIEKLRTKLDEAEKIDPEHFVSEIDARVTKIEGTHCEKRTFQCGGNEQECISDLLVCDGHKDCHNAHDEDPDVCDTSVVKAGNVFSGTSTWHGCLAREDHVTRITITASKRRKFFTARIWLRALVESELERHGENVTSSFNAKGYYNFASRRLILLPTDDHDDHLAVVCSFNRGDNERAECHRVTEATLHQCADLFVTLEEHDDHDDHDDDHHDDHGKHHGGKHH DIP protein Q2I743 original sequence version: 5 4F57F09C50811EE8 glb3_lumte Extracellular globin-3 Erythrocruorin Extracellular globin III Globin C protein protein lumte Lumbricus terrestris Common earthworm MLRQLLVLVGLAVVCLADEHEHCCSEEDHRIVQKQWDILWRDTESSKIKIGFGRLLLTKLAKDIPDVNDLFKRVDIEHAEGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQHEVREGVQKAHFKKFGEILATGLPQVLDDYDALAWKSCLKGILTKISSRLNA DIP protein P11069 original sequence version: 50 03306F66E8BE3057 glb1_lumte Extracellular globin-1 Erythrocruorin Globin D Globin I protein protein lumte Lumbricus terrestris Common earthworm ECLVTEGLKVKLQWASAFGHAHQRVAFGLELWKGILREHPEIKAPFSRVRGDNIYSPQFGAHSQRVLSGLDITISMLDTPDMLAAQLAHLKVQHVERNLKPEFFDIFLKHLLHVLGDRLGTHFDFGAWHDCVDQIIDGIKDI DIP protein P08924 original sequence version: 43 glb1_lumte-glb2_lumte-1 2 10 unspecified role unspecified role unspecified role unspecified role lumte Lumbricus terrestris Common earthworm 6 unspecified role unspecified role unspecified role unspecified role lumte Lumbricus terrestris Common earthworm 8 unspecified role unspecified role unspecified role unspecified role lumte Lumbricus terrestris Common earthworm 4 unspecified role unspecified role unspecified role unspecified role lumte Lumbricus terrestris Common earthworm 9 unspecified role unspecified role unspecified role unspecified role lumte Lumbricus terrestris Common earthworm 3 unspecified role unspecified role unspecified role unspecified role lumte Lumbricus terrestris Common earthworm 7 unspecified role unspecified role unspecified role unspecified role lumte Lumbricus terrestris Common earthworm physical association physical association glb1_lumte-glb2_lumte-2 1 5 unspecified role unspecified role unspecified role unspecified role lumte Lumbricus terrestris Common earthworm 10 unspecified role unspecified role unspecified role unspecified role lumte Lumbricus terrestris Common earthworm 8 unspecified role unspecified role unspecified role unspecified role lumte Lumbricus terrestris Common earthworm 4 unspecified role unspecified role unspecified role unspecified role lumte Lumbricus terrestris Common earthworm 9 unspecified role unspecified role unspecified role unspecified role lumte Lumbricus terrestris Common earthworm 3 unspecified role unspecified role unspecified role unspecified role lumte Lumbricus terrestris Common earthworm 7 unspecified role unspecified role unspecified role unspecified role lumte Lumbricus terrestris Common earthworm physical association physical association