DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Identification of a receptor necessary for Nogo-B stimulated chemotaxis and morphogenesis of endothelial cells. Identification of a receptor necessary for Nogo-B stimulated chemotaxis and morphogenesis of endothelial cells. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Miao RQ., Gao Y., Harrison KD., Prendergast J., Acevedo LM., Yu J., Hu F., Strittmatter SM., Sessa WC. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Miao RQ., Gao Y., Harrison KD., Prendergast J., Acevedo LM., Yu J., Hu F., Strittmatter SM., Sessa WC. DIP original experiment: DIP-263396X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Identification of a receptor necessary for Nogo-B stimulated chemotaxis and morphogenesis of endothelial cells. ngbr_human Dehydrodolichyl diphosphate synthase complex subunit NUS1 NUS1 C6orf68 NGBR Nuclear undecaprenyl pyrophosphate synthase 1 homolog Nogo-B receptor Cis-prenyltransferase subunit NgBR protein protein human Homo sapiens Human MTGLYELVWRVLHALLCLHRTLTSWLRVRFGTWNWIWRRCCRAASAAVLAPLGFTLRKPPAVGRNRRHHRHPRGGSCLAAAHHRMRWRADGRSLEKLPVHMGLVITEVEQEPSFSDIASLVVWCMAVGISYISVYDHQGIFKRNNSRLMDEILKQQQELLGLDCSKYSPEFANSNDKDDQVLNCHLAVKVLSPEDGKADIVRAAQDFCQLVAQKQKRPTDLDVDTLASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK DIP protein Q96E22 original sequence version: 105 mint Acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator. Able to regulate vascular remodeling and angiogenesis. Its similarity with UPP synthetase proteins suggests that it may act as a scaffold for the binding of isoprenyl lipids and/or prenylated proteins homomint E6A0C9D9B39D4BCA q9nqc3-2 Reticulon-4 RTN4 Foocen KIAA0886 NOGO Neurite outgrowth inhibitor Neuroendocrine-specific protein Neuroendocrine-specific protein C homolog RTN-x Reticulon-5 My043 SP1507 ASY Foocen-M Nogo-B RTN-xS Nogo-B1 RTN4B RTN4B1 protein protein human Homo sapiens Human MEDLDQSPLVSSSDSPPRPQPAFKYQFVREPEDEEEEEEEEEEDEDEDLEELEVLERKPAAGLSAAPVPTAPAAGAPLMDFGNDFVPPAPRGPLPAAPPVAPERQPSWDPSPVSSTVPAPSPLSAAAVSPSKLPEDDEPPARPPPPPPASVSPQAEPVWTPPAPAPAAPPSTPAAPKRRGSSGSVVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE DIP protein Q9NQC3-2 original sequence version: 152 8A19379EF91A59B4 nus1-rtn4-1 1 2 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 3 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Region 1-200 Region 1-200 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association