DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The acute myeloid leukemia fusion protein AML1-ETO targets E proteins via a paired amphipathic helix-like TBP-associated factor homology domain. The acute myeloid leukemia fusion protein AML1-ETO targets E proteins via a paired amphipathic helix-like TBP-associated factor homology domain. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Plevin MJ., Zhang J., Guo C., Roeder RG., Ikura M. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Plevin MJ., Zhang J., Guo C., Roeder RG., Ikura M. DIP original experiment: DIP-263334X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The acute myeloid leukemia fusion protein AML1-ETO targets E proteins via a paired amphipathic helix-like TBP-associated factor homology domain. The acute myeloid leukemia fusion protein AML1-ETO targets E proteins via a paired amphipathic helix-like TBP-associated factor homology domain. The acute myeloid leukemia fusion protein AML1-ETO targets E proteins via a paired amphipathic helix-like TBP-associated factor homology domain. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Plevin MJ., Zhang J., Guo C., Roeder RG., Ikura M. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Plevin MJ., Zhang J., Guo C., Roeder RG., Ikura M. DIP original experiment: DIP-263333X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The acute myeloid leukemia fusion protein AML1-ETO targets E proteins via a paired amphipathic helix-like TBP-associated factor homology domain. q06455-4 Protein CBFA2T1 AML1T1 CBFA2T1 CDR Cyclin-D-related protein ETO Eight twenty one protein MTG8 Protein ETO Protein MTG8 ZMYND2 Zinc finger MYND domain-containing protein 2 RUNX1T1 protein protein human Homo sapiens Human MPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR DIP protein Q06455-4 original sequence version: 156 44AADF2EC7032050 q99081-3 Transcription factor 12 TCF12 BHLHB20 Class B basic helix-loop-helix protein 20 DNA-binding protein HTF4 E-box-binding protein HEB HTF4 Transcription factor HTF-4 c protein protein human Homo sapiens Human MNPQQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDERGGTTSWGTSGQPSPSYDSSRGFTDSPHYSDHLNDSRLGAHEGLSPTPFMNSNLMGKTSERGSFSLYSRDTGLPGCQSSLLRQDLGLGSPAQLSSSGKPGTAYYSFSATSSRRRPLHDSAALDPLQAKKVRKVPPGLPSSVYAPSPNSDDFNRESPSYPSPKPPTSMFASTFFMQDGTHNSSDLWSSSNGMSQPGFGGILGTSTSHMSQSSSYGNLHSHDRLSYPPHSVSPTDINTSLPPMSSFHRGSTSSSPYVAASHTPPINGSDSILGTRGNAAGSSQTGDALGKALASIYSPDHTSSSFPSNPSTPVGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLKNRVEQQLHEHLQDAMSFLKDVCEQSRMEDRLDRLDDAIHVLRNHAVGPSTSLPAGHSDIHSLLGPSHNAPIGSLNSNYGGSSLVASSRSASMVGTHREDSVSLNGNHSVLSSTVTTSSTDLNHKTQENYRGGLQSQSGTVVTTEIKTENKEKDENLHEPPSSDDMKSDDESSQKDIKVSSRGRTSSTNEDEDLNPEQKIEREKERRMANNARERLRVRDINEAFKELGRMCQLHLKSEKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSAVSAEPPTTLPGTHPGLSETTNPMGHM DIP protein Q99081-3 original sequence version: 136 75B7B4173C9B660D runx1t1-tcf12-1 2 4 unspecified role unspecified role unspecified role unspecified role Region 12-28 Region 12-28 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 3 unspecified role unspecified role unspecified role unspecified role Region 83-185 Region 83-185 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction tcf12-runx1t1-1 1 4 unspecified role unspecified role bait bait Region 11-27 Region 11-27 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 3 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q06455-4:p.Lys88Ala K88A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain K A This feature has been corrected as a result of our quality control procedures. The original label was 'K88A'. Wed May 02 19:16:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys88ala' Tue Jun 30 17:10:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys88Ala' Q06455-4:p.Lys88Asp K88D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain K D This feature has been corrected as a result of our quality control procedures. The original label was 'K88D'. Wed May 02 17:16:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys88asp' Tue Jun 30 17:04:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys88Asp' Q06455-4:p.Leu89Ala L89A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L89A'. Wed May 02 16:24:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu89ala' Tue Jun 30 19:13:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu89Ala' Q06455-4:p.Arg91Asp R91D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R D This feature has been corrected as a result of our quality control procedures. The original label was 'R91D'. Wed May 02 17:54:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg91asp' Tue Jun 30 18:13:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg91Asp' Q06455-4:p.Phe92Ala F92A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F92A'. Wed May 02 16:31:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe92ala' Tue Jun 30 19:46:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe92Ala' Q06455-4:p.Leu96Ala L96A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L96A'. Wed May 02 16:16:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu96ala' Tue Jun 30 17:29:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu96Ala' Q06455-4:p.Arg141Ala R141A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R141A'. Wed May 02 14:48:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg141ala' Tue Jun 30 17:14:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg141Ala' Q06455-4:p.Arg141Asp R141D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain R D This feature has been corrected as a result of our quality control procedures. The original label was 'R141D'. Wed May 02 16:11:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg141asp' Tue Jun 30 18:40:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg141Asp' Q06455-4:p.Phe147Ala F147A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F147A'. Wed May 02 17:35:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe147ala' Tue Jun 30 18:22:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe147Ala' Q06455-4:p.[Phe92Ala;Phe147Ala] F92A/F147A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F92A/F147A'. Wed May 02 20:03:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe92ala,phe147ala' Tue Jun 30 17:27:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe92Ala;Phe147Ala]' Q06455-4:p.[Leu89Ala;Arg141Asp] L89A/R141D mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain R D This feature has been corrected as a result of our quality control procedures. The original label was 'L89A/R141D'. Wed May 02 18:57:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu89ala,arg141asp' Tue Jun 30 19:47:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu89Ala;Arg141Asp]' in vitro In vitro direct interaction direct interaction