DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Isolation of the Cdc45/Mcm2-7/GINS (CMG) complex, a candidate for the eukaryotic DNA replication fork helicase. Isolation of the Cdc45/Mcm2-7/GINS (CMG) complex, a candidate for the eukaryotic DNA replication fork helicase. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Moyer SE., Lewis PW., Botchan MR. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Moyer SE., Lewis PW., Botchan MR. DIP original experiment: DIP-263325X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Isolation of the Cdc45/Mcm2-7/GINS (CMG) complex, a candidate for the eukaryotic DNA replication fork helicase. Isolation of the Cdc45/Mcm2-7/GINS (CMG) complex, a candidate for the eukaryotic DNA replication fork helicase. Isolation of the Cdc45/Mcm2-7/GINS (CMG) complex, a candidate for the eukaryotic DNA replication fork helicase. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Moyer SE., Lewis PW., Botchan MR. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Moyer SE., Lewis PW., Botchan MR. DIP original experiment: DIP-263327X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Isolation of the Cdc45/Mcm2-7/GINS (CMG) complex, a candidate for the eukaryotic DNA replication fork helicase. Isolation of the Cdc45/Mcm2-7/GINS (CMG) complex, a candidate for the eukaryotic DNA replication fork helicase. Isolation of the Cdc45/Mcm2-7/GINS (CMG) complex, a candidate for the eukaryotic DNA replication fork helicase. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Moyer SE., Lewis PW., Botchan MR. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Moyer SE., Lewis PW., Botchan MR. DIP original experiment: DIP-263323X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Isolation of the Cdc45/Mcm2-7/GINS (CMG) complex, a candidate for the eukaryotic DNA replication fork helicase. Isolation of the Cdc45/Mcm2-7/GINS (CMG) complex, a candidate for the eukaryotic DNA replication fork helicase. Isolation of the Cdc45/Mcm2-7/GINS (CMG) complex, a candidate for the eukaryotic DNA replication fork helicase. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Moyer SE., Lewis PW., Botchan MR. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Moyer SE., Lewis PW., Botchan MR. DIP original experiment: DIP-263326X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Isolation of the Cdc45/Mcm2-7/GINS (CMG) complex, a candidate for the eukaryotic DNA replication fork helicase. Isolation of the Cdc45/Mcm2-7/GINS (CMG) complex, a candidate for the eukaryotic DNA replication fork helicase. Isolation of the Cdc45/Mcm2-7/GINS (CMG) complex, a candidate for the eukaryotic DNA replication fork helicase. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Moyer SE., Lewis PW., Botchan MR. Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Moyer SE., Lewis PW., Botchan MR. DIP original experiment: DIP-263324X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Isolation of the Cdc45/Mcm2-7/GINS (CMG) complex, a candidate for the eukaryotic DNA replication fork helicase. mcm7_drome DNA replication licensing factor Mcm7 CG4978 Mcm7 Minichromosome maintenance 7 protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MARRDYAQDRESIKTFLSEFCKCDDDGKKEFVYGSQLVKLAHREQVLITIDLDDLAEFNESLAEAVVDNCRRYTSIFSDVIAELLPSYKQQEVHAKDALDVYIEHRLMMESRTRNPMEQRDERNSFPSELMKRFEVGFKPLSTEKAHSIREVKAQHIGKLVTVRGIVTRCTEVKPMMVVATYTCDRCGSETYQPVNSLSFTPVHDCPSDDCRVNKAGGRLYLQTRGSKFVKFQEVKMQEHSDQVPVGHIPRSMTIMCRGEVTRMAQPGDHIVVSGVFLPLMRTGFAQMIQGLLSETFLQAHRIICINKNDEISDKDAELTPEELEELAQDDFYERLATSLAPEIYGHLDVKKALLLLLVGGVDKRPDGMKIRGNINICLMGDPGVAKSQLLGYISRLAVRSQYTTGRGSSGVGLTAAVMKDPLTGEMTLEGGALVLADQGVCCIDEFDKMADQDRTAIHEVMEQQTISIAKAGIMTTLNARVSILAAANPAFGRYNPRRTVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLAKHITYVHSHSKQPPTRVKALDMNLMRRYINLCKRKNPTIPDELTDYIVGAYVELRREARNQKDMTFTSARNLLGILRLSTALARLRLSDSVEKDDVAEALRLLEMSKDSLNQIHEHQKGHVPNTSDRIFAIVRELAGSGKAVKISDIMDRCTTKGFKPDQVDKCIDDYEELNVWQVNMGRTKITFM DIP protein Q9XYU0 original sequence version: 118 DIP protein Q9XYU0 original sequence version: 87 09286B4D5E406756 q9w0i7_drome GINS complex subunit 1 Psf1 CG9187-PA Dmel\CG9187 psf1 Dmel_CG9187 CG9187 PSF1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSRQTKMFGEKAFDLLKELERSSQTIPAFDDDGVRQVLEEIKAIFEENVAQASSYNASGDRSLWPLLNFRHAALQRNKRCLLAYLYERCRRIKALRWEFGPIIPGDIKQALCEPEVTFFNNYSKSLAAYMCSAGYNQGLPIDLTNNLRPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYLPRAQVESLVRQGILHHIA DIP protein Q9W0I7 original sequence version: 111 DIP protein Q9W0I7 original sequence version: 79 39923E0ABC833E61 q9w2v7_drome DNA replication complex GINS protein PSF3 Dmel\CG2222 Psf3 PSF3 CG2222 Dmel_CG2222 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNGMNYFPNYYSIEDIFVTQEKVECRVNTKLQRMGFLDSGAESDDLEPGRTVNLPLWYIKELKVNNAYFTVAVPDIYRNVHKAVCEAETTHIELGRLHPYFYEFGRYLTPYDRNHVIGRIIFETLRQRVRHLLDISKSDGQAAKAEHRLDNIEAKLHEAGVRTNSQYIEWLQMTGNKIRTSELVEEHQKKRRRADRSDDEGDALPNSKRATL DIP protein Q9W2V7 original sequence version: 92 DIP protein Q9W2V7 original sequence version: 60 q9vbi1_drome DNA replication complex GINS protein SLD5 Sld5 Dmel\CG14549 anon-WO0172774.61 Dmel_CG14549 CG14549 SLD5 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSDVEDVPETQLEIDVSDGAGLEDEDDDDMEQITAQKVLEIIETAWINEMCAPEILPSQTDMLELMVSQVAHMEEQMRDLDKNDFRAVVHSMELERVRYIMASYLRCRLQKIETFTQHILNQEESREPDDKRLSPEETKFAQEFASNVDEYFHKVATQYMPNQQRGEAEQRIVTPNLMSHVFLKANVAVPAVIVGVDDEEVDMAAGSQHIIPYQLVADLIQNNQAQLI DIP protein Q9VBI1 original sequence version: 106 DIP protein Q9VBI1 original sequence version: 73 4CBA25E4AD59B4AE mcm4_drome DNA replication licensing factor MCM4 dpa CG1616 Protein disc proliferation abnormal protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSPARSPSVGGATPKQGARTPTRGIASQDVETPMRMGPGRAVRPSDNISLPPTSPGNISLPATSPARGLGANMSEIDLSSPLNYGTPSSMGSIRTPRSGIRGTPLRARPDIRTDKRIRQVAIGGGSGLEPIPEKGSETTDPVSESSQAPQLVVWGTNVVVSQCKSKFKSFIMRFIDPSAEQDEISENIDVNQPLYLQKLEEIHTLEEPYLNLNCAHLKTFDQDLYRQLICYPQEVIPGFDMAINEMFFERYPAALLEHQIQVRPFNADKTRNMRSLNPEDMDQLISISGMVIRSSNVIPEMREAFFSCNICSFSTTVEVDRGRINQPTLCTNCNTNHCFRLIHNRSEFTDKQLVKLQESPDDMAAGQTPHNVLLYAHNDLVDKVQPGDRVTVTGIYRATPLKTGGLSSSVKSVYKTHVDVVHFRKVDNKRLYEDEEGKDHIFPPERVELLQLLAKKPDIYDRLARAIAPSIYENDDIKKGILLQLFGGTKKKHATLGRQNFRSEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLVLQTGALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPAESQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLASHLVSLYYVTRHEEEDTMFDMSVLRDYIAYAREHLSPTLSDEAQQRLIQAYVDMRKVGAGRGQISAYPRQLESLIRLSEAHAKVRLSNQVELLDVEEAWRLHREALKQSATDPLSGKIDVGILTTGLSTAARKKRADLVAAIKENLKKKGKVLTVPYQKLFSDIKEGSQIMITREQFEDALKEVQDEGAIVVMGKNTIRIC DIP protein Q26454 original sequence version: 118 DIP protein Q26454 original sequence version: 90 CF6ED69D2ADDA04E mcm6_drome DNA replication licensing factor Mcm6 Mcm6 CG4039 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDVADAQVGQLRVKDEVGIRAQKLFQDFLEEFKEDGEIKYTRPAASLESPDRCTLEVSFEDVEKYDQNLATAIIEEYYHIYPFLCQSVSNYVKDRIGLKTQKDCYVAFTEVPTRHKVRDLTTSKIGTLIRISGQVVRTHPVHPELVSGVFMCLDCQTEIRNVEQQFKFTNPTICRNPVCSNRKRFMLDVEKSLFLDFQKIRIQETQAELPRGCIPRAVEIILRSELVETVQAGDRYDFTGTLIVVPDVSVLAGVGTRAENSSRHKPGEGMDGVTGLKALGMRELNYRMAFLACSVQATTARFGGTDLPMSEVTAEDMKKQMTDAEWHKIYEMSKDRNLYQNLISSLFPSIYGNDEVKRGILLQQFGGVAKTTTEKTSLRGDINVCIVGDPSTAKSQFLKQVSDFSPRAIYTSGKASSAAGLTAAVVRDEESFDFVIEAGALMLADNGICCIDEFDKMDQRDQVAIHEAMEQQTISIARAGVRATLNARTSILAAANPINGRYDRSKSLQQNIQLSAPIMSRFDLFFILVDECNEVVDYAIARKIVDLHSNIEESVERAYTREEVLRYVTFARQFKPVISQEAGHMLVENYGHLRQRDTGTSGRSTWRITVRQLESMIRLSEAMAKLECSNRVLERHVKEAFRLLNKSIIRVEQPDIHLDDDEGLDMDDGIQHDIDMENNGAAANVDENNGMDTSASGAVQKKKFTLSFEDYKNLSTMLVLHMRAEEARCEVEGNDTGIKRSNVVTWYLEQVADQIESEDELISRKNLIEKLIDRLIYHDQVIIPLKTSTLKPRIQVQKDFVEEDDPLLVVHPNYVVE DIP protein Q9V461 original sequence version: 114 DIP protein Q9V461 original sequence version: 86 0B7921FB3D888980 mcm2_drome DNA replication licensing factor Mcm2 Mcm2 CG7538 Minichromosome maintenance 2 protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDNPSSPPPNTPSDAAERRDLRAAMTSPVGDFEPFENEDEILGDQTVRDEAEEEDGEELFGDNMENDYRPMPELDHYDPALLDDEDDFSEMSQGDRFAAESEMRRRDRAAGIHRDDRDLGFGQSDDEDDVGPRAKRRAGEKAAVGEVEDTEMVESIENLEDTKGHSTKEWVSMLGPRTEIANRFQSFLRTFVDERGAYTYRDRIRRMCEQNMSSFVVSYTDLANKEHVLAYFLPEAPFQMLEIFDKVAKDMVLSIFPTYERVTTEIHVRISELPLIEELRTFRKLHLNQLVRTLGVVTATTGVLPQLSVIKYDCVKCGYVLGPFVQSQNTEIKPGSCPECQSTGPFSINMEQTLYRNYQKITLQESPGRIPAGRIPRSKDVILLADLCDQCKPGDELEVTGIYTNNYDGSLNTDQGFPVFATVIIANHVVVKDSKQVVQSLTDEDIATIQKLSKDPRIVERVVASMAPSIYGHDYIKRALALALFGGESKNPGEKHKVRGDINLLICGDPGTAKSQFLKYTEKVAPRAVFTTGQGASAVGLTAYVRRNPVSREWTLEAGALVLADQGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSMTFSENVNLSEPILSRFDVLCVVKDEFDPMQDQQLAKFVVHSHMKHHPSEEEQPELEEPQLKTVDEIPQDLLRQYIVYAKENIRPKLTNIDEDKIAKMYAQLRQESFATGSLPITVRHIESVIRMSEAHARMHLRENVMEADVSMAIRMMLESFIEAQKFSVMKKMRSTFQKYLSFQKDHSELLFFILRQLTLDQLAYIRCKDGPGATHVEIMERDLIERAKQLDIVNLKPFYESDLFRTNGFSYDPKRRIILQIVVDGNTA DIP protein P49735 original sequence version: 127 DIP protein P49735 original sequence version: 94 26A7092109F09CBE mcm5_drome DNA replication licensing factor Mcm5 Mcm5 CG4082 Minichromosome maintenance 5 protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEGFDDAGVFFSDNFGGDNQQDAQINLQAVKKKYKEFIRTFNEENFFYKYRDTLKRNYLNGRYFLEIEMEDLVGFDETLADKLNKQPTEHLEIFEEAAREVADEITAPRPEHEEHMHDIQILLSSNANPTNIRQLKSDCVSKLVKIAGIIVAASGISAKATRMSIQCLSCSTVIPNLKVNPGLEGYALPRKCNTEQAGRPKCPLDPFFIMPDKCKCVDFQTLKLQELPDFVPQGEIPRHLQLFCDRSLCERVVPGNRVLIQGIYSIRKVGKPSRRDGREKAVVGVRAPYMRVVGITVDSEGAGAISRYSNITSDEEEHFRRMAASGDIYERLSQSLAPSIFGSRDIKKAITCMLFGGSRKRLPDGLCRRGDINVLLLGDPGTAKSQLLKFVEKVAPIAVYTSGKGSSAAGLTASVMKDPQTRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSIFGRWDDTKGEENIDFMPTILSRFDMIFIVKDIHDESRDITLAKHIINVHLSSNKSAPSEPAEGEISLSTFKKYIHYCRTHCGPRLSEAAGEKLKSRYVLMRSGAGQQEKASDKRLSIPITVRQLEAVIRISESLAKIRLQPFATDEHVNEALRLFQVSTLDAAMTGSLAGAEGFTTEEDQETLNRIEKQLKRRFAIGSQVSEQNILQDFLRQKYEERTVMKVIHTMIRRGELQHRMQRKMLYRIC DIP protein Q9VGW6 original sequence version: 126 DIP protein Q9VGW6 original sequence version: 95 36FEB693045A30B8 mcm3_drome DNA replication licensing factor Mcm3 Mcm3 CG4206 Mcm3-RA Minichromosome maintenance 3 protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAHEGEQFIKDIQREYVDFLDDEEDQGIYAGHVKDMIAEKSKRLIVNVNDLKRKNPQRALGLLSNAADEQLAFGRALKEYASTVDPGYAKMHEDLFVGFEGCFGNRHVTPRSLTSIYLGNMVCVEGIVTKVSLIRPKVVRSVHYCPNTRKVMERKYTDLTSFEAVPSGAAYPTKDEDGNLLETEYGLSVYKDHQTLTIQEMPEKAPAGQLPRSVDIVCDDDLVDRCKPGDRVQIVGSYRCLPGKRGGYTSGTFRTVLLANNISLLSKESNLDISREDIMLCKKLAKNNDIFELLSKSLAPSIHGHAYVKQAILCLLLGGVEKILPNGTRLRGDINVLLIGDPSVAKSQLLRYVLNTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHASLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFVMLDVIDSDVDQMISDHVVRMHRYRNPKEADGEPLSMGSSYADSLSFVSSSEEKKDTEVYEKYDALLHGKSRQRHEKILSVEFMRKYIHIAKCMKPKLGEQACEAIANEYSRLRSQEAVETDVARTQPITARTLETLIRLSTAHARARMSKSVTIDDAHAAIELVQFAYFKKVLDKDRPSKRRRNSGSDAEDDNGEASSQRSPSRRSKRTRTATVGADSDEEDIEPPQPDAGDLTRRETRRSLPARSVAMLMASPSSEEQSVATSTTEPAIISDARLGEFKNNLQRLFREAREQSLALARITTAINVGSQEPFTAGEIEAAVHRMTEDNQIMVADDIVFLI DIP protein Q9XYU1 original sequence version: 124 DIP protein Q9XYU1 original sequence version: 92 CE4C14FE89BA8113 psf2_drome Probable DNA replication complex GINS protein PSF2 CG18013 GINS complex subunit 2 Psf2 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDPSIIEFIGEKCMISIIPNFSNEPLHLIYGPVGPFRAGFPVFVPLWMATHLRKQQKCRIVPPEWMDMDILEEIKEEEKRSKFFTKMPCEHYMVVAQLVMSTAPDDVPRCEELRTVIKDIFDIRESKLRTSIDAFIKGEGTYAKLDNLTLLEIHSVRPILPYSLDHIARYQRTATASQRDTSMLSASMAGSSSGPNSNSLFSQ DIP protein Q9VQY9 original sequence version: 87 DIP protein Q9VQY9 original sequence version: 61 632BEDDFB434B3DE o96989_drome Cdc45 CDC45 CDC45L D DmCdc45 Dmel\CG3658 EG:BACR7A4.11 anon-1Ec cdc45 dCDC45 dCDC45L CG3658 Dmel_CG3658 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MFVQDLRNDFYRQLVGKRILIVVNYDIDAICASRILQALFKYDHMLYTVVPIMGVTGLKRAYGEHQGDVKYVVLVNCGGCVDIVELLQPSDDVTFFICDSHRPLDVCNIYSDRQVCILGDASLEENIPAFETIFYDSEGEDEDEDESSDTEQQHDDSGAGESDQEDQAPRSRKLSRLERHEQRILKQRARRQWESERDRIMFEYTQFSYYGRSAALMVFELAWKLSKDNMDLLWWAIVGITEQLLLGKIESGAYTLELEQIQSHVSRLTNKTNDQNTMSASKITFENDLHLVLYRHWPVTESMRYSRYSSCQLKLWTLRGEKRLHELLLEMGLPLVHARQTYGAMDLVLRKEFFSMVERLAEKYDIADIVYGTFTLSYGYRSRYAAADYVYALLAIMESVKKHKTPEDCFLEASDALSRQHKQLLSAGIDQAKLLHAAVFRQVQSSLEARQVHSAGSFFYYVLQEEHAFFSYPYALGLLARFLLRGHVATSRARQASDLPLIASCPLNASEGMCLLVGIVPVREDSPRNFFGKAFEQAAQKSGVALLQDFFEPAVVQLRQSDLTRFLDSLTVLLA DIP protein O96989 original sequence version: 121 DIP protein O96989 original sequence version: 83 A58341D46DEFE618 cdc45l-dpa-1 3 8 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 15 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 7 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 9 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 6 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 11 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 13 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 10 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 14 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 12 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 16 unspecified role unspecified role bait bait drome Drosophila melanogaster (Fruit fly) Fruit fly association association psf2-cdc45l-1 1 8 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 15 unspecified role unspecified role bait bait drome Drosophila melanogaster (Fruit fly) Fruit fly 7 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 9 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 6 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 11 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 13 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 10 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 14 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 12 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 16 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly association association mcm6-dpa-1 2 6 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 11 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 10 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 12 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly association association cdc45l-dpa-2 5 8 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 15 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 7 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 9 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 6 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 11 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 13 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 10 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 14 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 12 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 16 unspecified role unspecified role bait bait drome Drosophila melanogaster (Fruit fly) Fruit fly association association cdc45l-dpa-3 4 8 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 15 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 7 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 9 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 6 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 11 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome Drosophila melanogaster (Fruit fly) Fruit fly 13 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 10 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 14 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 12 unspecified role unspecified role prey prey drome Drosophila melanogaster (Fruit fly) Fruit fly 16 unspecified role unspecified role bait bait drome Drosophila melanogaster (Fruit fly) Fruit fly association association