DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The PINc domain protein Utp24, a putative nuclease, is required for the early cleavage steps in 18S rRNA maturation. The PINc domain protein Utp24, a putative nuclease, is required for the early cleavage steps in 18S rRNA maturation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Bleichert F., Granneman S., Osheim YN., Beyer AL., Baserga SJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Bleichert F., Granneman S., Osheim YN., Beyer AL., Baserga SJ. DIP original experiment: DIP-263195X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The PINc domain protein Utp24, a putative nuclease, is required for the early cleavage steps in 18S rRNA maturation. The PINc domain protein Utp24, a putative nuclease, is required for the early cleavage steps in 18S rRNA maturation. The PINc domain protein Utp24, a putative nuclease, is required for the early cleavage steps in 18S rRNA maturation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Bleichert F., Granneman S., Osheim YN., Beyer AL., Baserga SJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Bleichert F., Granneman S., Osheim YN., Beyer AL., Baserga SJ. DIP original experiment: DIP-263194X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The PINc domain protein Utp24, a putative nuclease, is required for the early cleavage steps in 18S rRNA maturation. The PINc domain protein Utp24, a putative nuclease, is required for the early cleavage steps in 18S rRNA maturation. The PINc domain protein Utp24, a putative nuclease, is required for the early cleavage steps in 18S rRNA maturation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Bleichert F., Granneman S., Osheim YN., Beyer AL., Baserga SJ. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Bleichert F., Granneman S., Osheim YN., Beyer AL., Baserga SJ. DIP original experiment: DIP-263196X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The PINc domain protein Utp24, a putative nuclease, is required for the early cleavage steps in 18S rRNA maturation. utp23_yeast rRNA-processing protein UTP23 U3 small nucleolar RNA-associated protein 23 U three protein 23 UTP23 YOR004W protein protein yeast Saccharomyces cerevisiae Baker's yeast MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQADVKVMITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYVVASQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLNDPNIEKLQESGDGSGKESITKKRKLGPKAPNPLSVKKKKKVNSPSDEVKDKEDTSKEKKKRRRRKHKSNTNVPVSNGTTAAQ 27D00C72F6B492F6 27D00C72F6B492F6 utp8_yeast U3 small nucleolar RNA-associated protein 8 UTP8 t-UTP8 U three protein 8 U3 protein 8 required for transcription YGR128C protein protein yeast Saccharomyces cerevisiae Baker's yeast MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPTPKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGLMVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKIDTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDKVCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKTFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGNNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFPLSRTRNLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQEMKKLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENLTLYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 6F5AE1492F841F49 6F5AE1492F841F49 mpp10_yeast U3 small nucleolar RNA-associated protein MPP10 MPP10 YJR002W J1411 YJR83.5 M phase phosphoprotein 10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSELFGVLKSNAGRIILKDPSATSKDVKAYIDSVINTCKNGSITKKAELDEITVDGLDANQVWWQVKLVLDSIDGDLIQGIQELKDVVTPSHNLSDGSTLNSSSGEESELEEAESVFKEKQMLSADVSEIEEQSNDSLSENDEEPSMDDEKTSAEAAREEFAEEKRISSGQDERHSSPDPYGINDKFFDLEKFNRDTLAAEDSNEASEGSEDEDIDYFQDMPSDDEEEEAIYYEDFFDKPTKEPVKKHSDVKDPKEDEELDEEEHDSAMDKVKLDLFADEEDEPNAEGVGEASDKNLSSFEKQQIEIRKQIEQLENEAVAEKKWSLKGEVKAKDRPEDALLTEELEFDRTAKPVPVITSEVTESLEDMIRRRIQDSNFDDLQRRTLLDITRKSQRPQFELSDVKSSKSLAEIYEDDYTRAEDESALSEELQKAHSEISELYANLVYKLDVLSSVHFVPKPASTSLEIRVETPTISMEDAQPLYMSNASSLAPQEIYNVGKAEKDGEIRLKNGVAMSKEELTREDKNRLRRALKRKRSKANLPNVNKRSKRNDVVDTLSKAKNITVINQKGEKKDVSGKTKKSRSGPDSTNIKL DEAF52FC003A0FFD DEAF52FC003A0FFD fcf1_yeast rRNA-processing protein FCF1 FAF1-copurifying factor 1 FCF1 D9651.9 YDR339C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGKAKKTRKFGLVKRTLNTKKDQRLKKNQENIKTKEDPELTRNIPQVSSALFFQYNQAIKPPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAKCNPLITDCVMAELEKLGPKYRIALKLARDPRIKRLSCSHKGTYADDCLVHRVLQHKCYIVATNDAGLKQRIRKIPGIPLMSVGGHAYVIEKLPDVF 0089AD246BA08473 0089AD246BA08473 utp24-mpp10-1 2 7 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association utp23-mpp10-1 1 4 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association utp8-mpp10-2 3 5 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association