DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Trif-related adapter molecule is phosphorylated by PKC{epsilon} during Toll-like receptor 4 signaling. Trif-related adapter molecule is phosphorylated by PKC{epsilon} during Toll-like receptor 4 signaling. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation McGettrick AF., Brint EK., Palsson-McDermott EM., Rowe DC., Golenbock DT., Gay NJ., Fitzgerald KA., O'Neill LA. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra McGettrick AF., Brint EK., Palsson-McDermott EM., Rowe DC., Golenbock DT., Gay NJ., Fitzgerald KA., O'Neill LA. DIP original experiment: DIP-263186X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Trif-related adapter molecule is phosphorylated by PKC{epsilon} during Toll-like receptor 4 signaling. Trif-related adapter molecule is phosphorylated by PKC{epsilon} during Toll-like receptor 4 signaling. Trif-related adapter molecule is phosphorylated by PKC{epsilon} during Toll-like receptor 4 signaling. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation McGettrick AF., Brint EK., Palsson-McDermott EM., Rowe DC., Golenbock DT., Gay NJ., Fitzgerald KA., O'Neill LA. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined McGettrick AF., Brint EK., Palsson-McDermott EM., Rowe DC., Golenbock DT., Gay NJ., Fitzgerald KA., O'Neill LA. DIP original experiment: DIP-263185X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Trif-related adapter molecule is phosphorylated by PKC{epsilon} during Toll-like receptor 4 signaling. q86xr7-1 TIR domain-containing adapter molecule 2 TICAM2 TIRAP3 TIRP TRAM Putative NF-kappa-B-activating protein 502 TRIF-related adapter molecule Toll-like receptor adaptor protein 3 Toll/interleukin-1 receptor domain-containing protein TRAM protein protein human Homo sapiens Human MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQEGAQSVEEMFEEEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQHLQNLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPLPRERTPFALQTINALEEESRGFPTQVERIFQESVYKTQQTIWKETRNMVQRQFIA DIP protein Q86XR7-1 original sequence version: 117 kpce_human Protein kinase C epsilon type nPKC-epsilon PRKCE PKCE protein protein human Homo sapiens Human MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP DIP protein Q02156 original sequence version: 154 DIP protein Q02156 original sequence version: 119 85032D0A091A1F7F prkce-ticam2-1 2 4 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 3 enzyme target enzyme target substrate substrate unspecified role unspecified role Q86XR7-1:p.Ser16Ala S16A mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A This feature has been corrected as a result of our quality control procedures. The original label was 'S16A'. Wed May 02 15:37:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser16ala' Tue Jun 30 19:35:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser16Ala' ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation prkce-5 1 4 putative self putative self unspecified role unspecified role ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation true