DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Nature 2006 imex curation Schäfer T., Maco B., Petfalski E., Tollervey D., Böttcher B., Aebi U., Hurt E. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Schäfer T., Maco B., Petfalski E., Tollervey D., Böttcher B., Aebi U., Hurt E. DIP original experiment: DIP-254855X Nature 2006 IMEx Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Nature 2006 imex curation Schäfer T., Maco B., Petfalski E., Tollervey D., Böttcher B., Aebi U., Hurt E. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Schäfer T., Maco B., Petfalski E., Tollervey D., Böttcher B., Aebi U., Hurt E. DIP original experiment: DIP-254859X Nature 2006 IMEx Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Nature 2006 imex curation Schäfer T., Maco B., Petfalski E., Tollervey D., Böttcher B., Aebi U., Hurt E. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Schäfer T., Maco B., Petfalski E., Tollervey D., Böttcher B., Aebi U., Hurt E. DIP original experiment: DIP-254854X Nature 2006 IMEx Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Nature 2006 imex curation Schäfer T., Maco B., Petfalski E., Tollervey D., Böttcher B., Aebi U., Hurt E. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Schäfer T., Maco B., Petfalski E., Tollervey D., Böttcher B., Aebi U., Hurt E. DIP original experiment: DIP-254856X Nature 2006 IMEx Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Nature 2006 imex curation Schäfer T., Maco B., Petfalski E., Tollervey D., Böttcher B., Aebi U., Hurt E. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Schäfer T., Maco B., Petfalski E., Tollervey D., Böttcher B., Aebi U., Hurt E. DIP original experiment: DIP-254858X Nature 2006 IMEx Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. Nature 2006 imex curation Schäfer T., Maco B., Petfalski E., Tollervey D., Böttcher B., Aebi U., Hurt E. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast tap tandem affinity purification TAP TAP tap predetermined predetermined participant predetermined Schäfer T., Maco B., Petfalski E., Tollervey D., Böttcher B., Aebi U., Hurt E. DIP original experiment: DIP-254857X Nature 2006 IMEx Hrr25-dependent phosphorylation state regulates organization of the pre-40S subunit. eif3c_yeast Eukaryotic translation initiation factor 3 subunit C NIP1 YMR309C YM9924.01C YM9952.11C Eukaryotic translation initiation factor 3 93 kDa subunit Nuclear transport protein NIP1 Translation initiation factor eIF3, p93 subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRFFSSNYEYDVASSSSEEDLLSSSEEDLLSSSSSESELDQESDDSFFNESESESEADVDSDDSDAKPYGPDWFKKSEFRKQGGGSNKFLKSSNYDSSDEESDEEDGKKVVKSAKEKLLDEMQDVYNKISQAENSDDWLTISNEFDLISRLLVRAQQQNWGTPNIFIKVVAQVEDAVNNTQQADLKNKAVARAYNTTKQRVKKVSRENEDSMAKFRNDPESFDKEPTADLDISANGFTISSSQGNDQAVQEDFFTRLQTIIDSRGKKTVNQQSLISTLEELLTVAEKPYEFIMAYLTLIPSRFDASANLSYQPIDQWKSSFNDISKLLSILDQTIDTYQVNEFADPIDFIEDEPKEDSDGVKRILGSIFSFVERLDDEFMKSLLNIDPHSSDYLIRLRDEQSIYNLILRTQLYFEATLKDEHDLERALTRPFVKRLDHIYYKSENLIKIMETAAWNIIPAQFKSKFTSKDQLDSADYVDNLIDGLSTILSKQNNIAVQKRAILYNIYYTALNKDFQTAKDMLLTSQVQTNINQFDSSLQILFNRVVVQLGLSAFKLCLIEECHQILNDLLSSSHLREILGQQSLHRISLNSSNNASADERARQCLPYHQHINLDLIDVVFLTCSLLIEIPRMTAFYSGIKVKRIPYSPKSIRRSLEHYDKLSFQGPPETLRDYVLFAAKSMQKGNWRDSVKYLREIKSWALLPNMETVLNSLTERVQVESLKTYFFSFKRFYSSFSVAKLAELFDLPENKVVEVLQSVIAELEIPAKLNDEKTIFVVEKGDEITKLEEAMVKLNKEYKIAKERLNPPSNRR EE05097C44C45A4C EE05097C44C45A4C rs3_yeast 40S ribosomal protein S3 RPS3 SUF14 YNL178W N1653 YS3 RP13 Small ribosomal subunit protein uS3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVALISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRATRTQDVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQAESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKFADGFLIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRDPAKSRTGPKALPDAVTIIEPKEEEPILAPSVKDYRPAEETEAQAEPVEA B85C0DFEB011745F B85C0DFEB011745F rps8a_rps8b_yeast rs8a_yeast/rs8b_yeast molecule set molecule set yeast Saccharomyces cerevisiae Baker's yeast MGISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGAKRIHSVRTRGGNKKYRALRIETGNFSWASEGISKKTRIAGVVYHPSNNELVRTNTLTKAAIVQIDATPFRQWFEAHYGQTLGKKKNVKEEETVAKSKNAERKWAARAASAKIESSVESQFSAGRLYACISSRPGQSGRCDGYILEGEELAFYLRRLTAKK P0CX39,P0CX40 ltv1_yeast Protein LTV1 LTV1 YKL143W YKL2 Low-temperature viability protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKKFSSKNSQRYVVVHRPHDDPSFYDTDASAHVLVPVSNPNKTSPEADLRKKDVSSTKPKGRRAHVGEAALYGINFDDSEYDYTQHLKPIGLDPENSIFIASKGNEQKVEKKNIEDLFIEPKYRRDEIEKDDALPVFQRGMAKPEYLLHQQDTTDEIRGFKPDMNPALREVLEALEDEAYVVNDDVVVEDISKKTQLQGDNYGEEEKEDDIFAQLLGSGEAKDEDEFEDEFDEWDIDNVENFEDENYVKEMAQFDNIENLEDLENIDYQADVRRFQKDNSILEKHNSDDEFSNAGLDSVNPSEEEDVLGELPSIQDKSKTGKKKRKSRQKKGAMSDVSGFSMSSSAIARTETMTVLDDQYDQIINGYENYEEELEEDEEQNYQPFDMSAERSDFESMLDDFLDNYELESGGRKLAKKDKEIERLKEAADEVSKGKLSQRRNRERQEKKKLEKVTNTLSSLKF F432C239B3B0A68A F432C239B3B0A68A rio2_yeast Serine/threonine-protein kinase RIO2 N1342 YNL207W RIO2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKLDTSHMRYLTTDDFRVLQAVEQGSRSHEVVPTPLIHQISGMRSQSGTNRAISDLAKLSLISKMRNVKYDGYRLTYNGIDYLALKTMLNRDTVYSVGNTIGVGKESDIYKVSDKNGNPRVMKIHRLGRTSFHSVRNNRDYLKKSNQGANWMHLSRLAANKEYQFMSMLYSKGFKVPEPFDNSRHIVVMELIEGYPMRRLRKHKNIPKLYSDLMCFIVDLANSGLIHCDFNEFNIMIKDKLEDENDCGFVVIDFPQCISIQHQDADYYFQRDVDCIRRFFKKKLKYEPKPDSSMLDTEGFGDGYKYAYPDFKRDVKRTDNLDELVQASGFSKKHPGDRGLETAVESMRNAVYNSDDDMSNDEAEEENGEGDYSEEDEYYDSELDNESSEDDSEDAQEEENERIIEALSSGVENLKMDKLGNYILE 02117D0328118E8D 02117D0328118E8D rio2-rps3-1 3 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association rio2-rps3-2 4 8 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 11 unspecified role unspecified role bait bait TAP-tag TAP-tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ltv1-rio2-1 5 11 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role bait bait TAP-Tag TAP-Tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ltv1-rps3-1 1 10 unspecified role unspecified role bait bait TAP-Tag TAP-Tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association ltv1-rps3-2 6 10 unspecified role unspecified role bait bait TAP-Tag TAP-Tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association nip1-rps3-1 2 7 unspecified role unspecified role bait bait TAP-Tag TAP-Tag tandem tag tandem tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 8 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association