DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. Nature structural & molecular biology 2006 imex curation Goldstrohm AC., Hook BA., Seay DJ., Wickens M. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Goldstrohm AC., Hook BA., Seay DJ., Wickens M. DIP original experiment: DIP-66252X Nature structural & molecular biology 2006 IMEx PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. Nature structural & molecular biology 2006 imex curation Goldstrohm AC., Hook BA., Seay DJ., Wickens M. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Goldstrohm AC., Hook BA., Seay DJ., Wickens M. DIP original experiment: DIP-66249X Nature structural & molecular biology 2006 IMEx PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. Nature structural & molecular biology 2006 imex curation Goldstrohm AC., Hook BA., Seay DJ., Wickens M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Goldstrohm AC., Hook BA., Seay DJ., Wickens M. DIP original experiment: DIP-66246X Nature structural & molecular biology 2006 IMEx PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. Nature structural & molecular biology 2006 imex curation Goldstrohm AC., Hook BA., Seay DJ., Wickens M. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Goldstrohm AC., Hook BA., Seay DJ., Wickens M. DIP original experiment: DIP-66257X Nature structural & molecular biology 2006 IMEx PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. Nature structural & molecular biology 2006 imex curation Goldstrohm AC., Hook BA., Seay DJ., Wickens M. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Goldstrohm AC., Hook BA., Seay DJ., Wickens M. DIP original experiment: DIP-66256X Nature structural & molecular biology 2006 IMEx PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. Nature structural & molecular biology 2006 imex curation Goldstrohm AC., Hook BA., Seay DJ., Wickens M. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Goldstrohm AC., Hook BA., Seay DJ., Wickens M. DIP original experiment: DIP-66254X Nature structural & molecular biology 2006 IMEx PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. Nature structural & molecular biology 2006 imex curation Goldstrohm AC., Hook BA., Seay DJ., Wickens M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Goldstrohm AC., Hook BA., Seay DJ., Wickens M. DIP original experiment: DIP-66242X Nature structural & molecular biology 2006 IMEx PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. Nature structural & molecular biology 2006 imex curation Goldstrohm AC., Hook BA., Seay DJ., Wickens M. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Goldstrohm AC., Hook BA., Seay DJ., Wickens M. DIP original experiment: DIP-66244X Nature structural & molecular biology 2006 IMEx PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. Nature structural & molecular biology 2006 imex curation Goldstrohm AC., Hook BA., Seay DJ., Wickens M. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Goldstrohm AC., Hook BA., Seay DJ., Wickens M. DIP original experiment: DIP-66255X Nature structural & molecular biology 2006 IMEx PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. Nature structural & molecular biology 2006 imex curation Goldstrohm AC., Hook BA., Seay DJ., Wickens M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Goldstrohm AC., Hook BA., Seay DJ., Wickens M. DIP original experiment: DIP-66243X Nature structural & molecular biology 2006 IMEx PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. Nature structural & molecular biology 2006 imex curation Goldstrohm AC., Hook BA., Seay DJ., Wickens M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Goldstrohm AC., Hook BA., Seay DJ., Wickens M. DIP original experiment: DIP-66250X Nature structural & molecular biology 2006 IMEx PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. Nature structural & molecular biology 2006 imex curation Goldstrohm AC., Hook BA., Seay DJ., Wickens M. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Goldstrohm AC., Hook BA., Seay DJ., Wickens M. DIP original experiment: DIP-66251X Nature structural & molecular biology 2006 IMEx PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. Nature structural & molecular biology 2006 imex curation Goldstrohm AC., Hook BA., Seay DJ., Wickens M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Goldstrohm AC., Hook BA., Seay DJ., Wickens M. DIP original experiment: DIP-66247X Nature structural & molecular biology 2006 IMEx PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. Nature structural & molecular biology 2006 imex curation Goldstrohm AC., Hook BA., Seay DJ., Wickens M. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Goldstrohm AC., Hook BA., Seay DJ., Wickens M. DIP original experiment: DIP-66253X Nature structural & molecular biology 2006 IMEx PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. PUF proteins bind Pop2p to regulate messenger RNAs. Nature structural & molecular biology 2006 imex curation Goldstrohm AC., Hook BA., Seay DJ., Wickens M. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Goldstrohm AC., Hook BA., Seay DJ., Wickens M. DIP original experiment: DIP-66248X Nature structural & molecular biology 2006 IMEx PUF proteins bind Pop2p to regulate messenger RNAs. dcp1_yeast mRNA-decapping enzyme subunit 1 DCP1 YOL149W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTGAATAAENSATQLEFYRKALNFNVIGRYDPKIKQLLFHTPHASLYKWDFKKDEWNKLEYQGVLAIYLRDVSQNTNLLPVSPQEVDIFDSQNGSNNIQVNNGSDNSNRNSSGNGNSYKSNDSLTYNCGKTLSGKDIYNYGLIILNRINPDNFSMGIVPNSVVNKRKVFNAEEDTLNPLECMGVEVKDELVIIKNLKHEVYGIWIHTVSDRQNIYELIKYLLENEPKDSFA 8456B1C96C121C4D 8456B1C96C121C4D mpt5_yeast Suppressor protein MPT5 HTR1 PUF5 Protein HTR1 BIC834 YGL178W MPT5 Pumilio homology domain family member 5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MINNEPFPSADSASILTTSTSNNSLMSYNHQPQLSINSVQSLLEPVTPPPLGQMNNKRNHQKAHSLDLSGFNQFISSTQSPLALMNNTSTSNSANSFSPNPNAASNSTGLSASMANPPAILPLINEFDLEMDGPRRKSSHDFTVVAPSNSGVNTSSLIMETPSSSVTPAASLRNFSNSNNAASKCGVDNSSFGLSSSTSSSMVEISALPLRDLDYIKLATDQFGCRFLQKKLETPSESNMVRDLMYEQIKPFFLDLILDPFGNYLVQKLCDYLTAEQKTLLIQTIYPNVFQISINQYGTRSLQKIIDTVDNEVQIDLIIKGFSQEFTSIEQVVTLINDLNGNHVIQKCIFKFSPSKFGFIIDAIVEQNNIITISTHKHGCCVLQKLLSVCTLQQIFKISVKIVQFLPGLINDQFGNYIIQFLLDIKELDFYLLAELFNRLSNELCQLSCLKFSSNVVEKFIKKLFRIITGFIVNNNGGASQRTAVASDDVINASMNILLTTIDIFTVNLNVLIRDNFGNYALQTLLDVKNYSPLLAYNKNSNAIGQNSSSTLNYGNFCNDFSLKIGNLIVLTKELLPSIKTTSYAKKIKLKVKAYAEATGIPFTDISPQVTAMSHNNLQTINNENKNPHNKNSHNHNHNHNHNHAHNNNNNNNQKSHTRHFSLPANAYHRRSNSSVTNNFSNQYAQDQKIHSPQQIMNFNQNAYPSMGAPSFNSQTNPPLVSHNSLQNFDNRQFANLMAHPNSAAPIHSFSSSNITNVNPNVSRGFKQPGFMMNETDKINANHFSPYSNANSQNFNESFVPRMQYQTEGANWDSSLSMKSQHIGQGPYNQVNMSRNASISNMPAMNTARTSDELQFTLP 6B289BAF3CEA2200 6B289BAF3CEA2200 puf4_yeast Pumilio homology domain family member 4 PUF4 YGL023 YGL014W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTKGLKEEIDDVPSVDPVVSETVNSALEQLQLDDPEENATSNAFANKVSQDSQFANGPPSQMFPHPQMMGGMGFMPYSQMMQVPHNPCPFFPPPDFNDPTAPLSSSPLNAGGPPMLFKNDSLPFQMLSSGAAVATQGGQNLNPLINDNSMKVLPIASADPLWTHSNVPGSASVAIEETTATLQESLPSKGRESNNKASSFRRQTFHALSPTDLINAANNVTLSKDFQSDMQNFSKAKKPSVGANNTAKTRTQSISFDNTPSSTSFIPPTNSVSEKLSDFKIETSKEDLINKTAPAKKESPTTYGAAYPYGGPLLQPNPIMPGHPHNISSPIYGIRSPFPNSYEMGAQFQPFSPILNPTSHSLNANSPIPLTQSPIHLAPVLNPSSNSVAFSDMKNDGGKPTTDNDKAGPNVRMDLINPNLGPSMQPFHILPPQQNTPPPPWLYSTPPPFNAMVPPHLLAQNHMPLMNSANNKHHGRNNNSMSSHNDNDNIGNSNYNNKDTGRSNVGKMKNMKNSYHGYYNNNNNNNNNNNNNNNSNATNSNSAEKQRKIEESSRFADAVLDQYIGSIHSLCKDQHGCRFLQKQLDILGSKAADAIFEETKDYTVELMTDSFGNYLIQKLLEEVTTEQRIVLTKISSPHFVEISLNPHGTRALQKLIECIKTDEEAQIVVDSLRPYTVQLSKDLNGNHVIQKCLQRLKPENFQFIFDAISDSCIDIATHRHGCCVLQRCLDHGTTEQCDNLCDKLLALVDKLTLDPFGNYVVQYIITKEAEKNKYDYTHKIVHLLKPRAIELSIHKFGSNVIEKILKTAIVSEPMILEILNNGGETGIQSLLNDSYGNYVLQTALDISHKQNDYLYKRLSEIVAPLLVGPIRNTPHGKRIIGMLHLDS 659BA1062439F642 659BA1062439F642 ccr4_yeast CCR4-Not complex 3'-5'-exoribonuclease subunit Ccr4 CCR4 Carbon catabolite repressor protein 4 Cytoplasmic deadenylase Glucose-repressible alcohol dehydrogenase transcriptional effector FUN27 YAL021C protein protein yeast Saccharomyces cerevisiae Baker's yeast MNDPSLLGYPNVGPQQQQQQQQQQHAGLLGKGTPNALQQQLHMNQLTGIPPPGLMNNSDVHTSSNNNSRQLLDQLANGNANMLNMNMDNNNNNNNNNNNNNNNGGGSGVMMNASTAAVNSIGMVPTVGTPVNINVNASNPLLHPHLDDPSLLNNPIWKLQLHLAAVSAQSLGQPNIYARQNAMKKYLATQQAQQAQQQAQQQAQQQVPGPFGPGPQAAPPALQPTDFQQSHIAEASKSLVDCTKQALMEMADTLTDSKTAKKQQPTGDSTPSGTATNSAVSTPLTPKIELFANGKDEANQALLQHKKLSQYSIDEDDDIENRMVMPKDSKYDDQLWHALDLSNLQIFNISANIFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRLTSLPAELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQFLGVEGNPLEKQFLKILTEKSVTGLIFYLRDNRPEIPLPHERRFIEINTDGEPQREYDSLQQSTEHLATDLAKRTFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEEYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHIPSGDTIWAVTTHLHWDPKFNDVKTFQVGVLLDHLETLLKEETSHNFRQDIKKFPVLICGDFNSYINSAVYELINTGRVQIHQEGNGRDFGYMSEKNFSHNLALKSSYNCIGELPFTNFTPSFTDVIDYIWFSTHALRVRGLLGEVDPEYVSKFIGFPNDKFPSDHIPLLARFEFMKTNTGSKKV 5CDB2E8FEDDBEF6F 5CDB2E8FEDDBEF6F cnot8 subunit 8 protein protein human Homo sapiens Human pop2_yeast Poly(A) ribonuclease POP2 POP2 CAF1 YNR052C N3470 CCR4-associated factor 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQGMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQQQQQQPFNIGTPVSVASLPPGLNVLQQQQQQQQQQQQQQQGVGLNRPLASQLPKHLTNQSMPPIFLPPPNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRSKVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKKEIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWITYHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEFKNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQLSKLSMHKFPNGTDFAKYQGVIYGIDGDQ F3CAF97106A65933 F3CAF97106A65933 dhh1_yeast ATP-dependent RNA helicase DHH1 DHH1 DExD/H-box helicase 1 YDL160C protein protein yeast Saccharomyces cerevisiae Baker's yeast MGSINNNFNTNNNSNTDLDRDWKTALNIPKKDTRPQTDDVLNTKGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKVKPKLNKIQALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPATIDKSLYVAENDETVPVPFPIEQQSYHQQAIPQQQLPSQQQFAIPPQQHHPQFMVPPSHQQQQAYPPPQMPSQQGYPPQQEHFMAMPPGQSQPQY 062CFA56DF6F2CEE 062CFA56DF6F2CEE cnot7_caeel CCR4-NOT transcription complex subunit 7 Y56A3A.20 ccf-1 CCR4-associated factor 1 protein protein caeel Caenorhabditis elegans MASSSSGGAGGAGGASGAPEVKIHNVYMSNVEEEFARIRGFVEDYPYVAMDTEFPGVVATPLGTFRSKEDFNYQQVFCNVNMLKLIQVGFAMVNDKGELPPTGDVWQFNFNFSFAEDMFSHESVEMLRQAGIDFTLLQNNGIPTAVFGELLTTSGLITDPRITWLTFSSGYDFGYLLKSITLGDLPKEESTFFMCHKTLFPTSFDIKILLRTPNCASAKLKGGLQEVADQLDVKRQGVRHQAGSDALLTAATFFKIKKQFFGDNWNQIAPLICGHMFGLGSSLSLFHSSGSTSRLGDETPQGLIGVPQQA DIP protein Q17345 original sequence version: 39 AC07E23BFFD1E5B0 pum1_human Pumilio homolog 1 PUM1 KIAA0099 PUMH1 protein protein human Homo sapiens Human MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGTHSSPVPGSIGVAGRSQDDAMVDYFFQRQHGEQLGGGGSGGGGYNNSKHRWPTGDNIHAEHQVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTSDHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGFGPRDADSDENDKGEKKNKGTFDGDKLGDLKEEGDVMDKTNGLPVQNGIDADVKDFSRTPGNCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQFDYSGTQVPVDSAAATVGLFDYNSQQQLFQRPNALAVQQLTAAQQQQYALAAAHQPHIGLAPAAFVPNPYIISAAPPGTDPYTAGLAAAATLGPAVVPHQYYGVTPWGVYPASLFQQQAAAAAAATNSANQQTTPQAQQGQQQVLRGGASQRPLTPNQNQQGQQTDPLVAAAAVNSALAFGQGLAAGMPGYPVLAPAAYYDQTGALVVNAGARNGLGAPVRLVAPAPVIISSSAAQAAVAAAAASANGAAGGLAGTTNGPFRPLGTQQPQPQPQQQPNNNLASSSFYGNNSLNSNSQSSSLFSQGSAQPANTSLGFGSSSSLGATLGSALGGFGTAVANSNTGSGSRRDSLTGSSDLYKRTSSSLTPIGHSFYNGLSFSSSPGPVGMPLPSQGPGHSQTPPPSLSSHGSSSSLNLGGLTNGSGRYISAAPGAEAKYRSASSASSLFSPSSTLFSSSRLRYGMSDVMPSGRSRLLEDFRNNRYPNLQLREIAGHIMEFSQDQHGSRFIQLKLERATPAERQLVFNEILQAAYQLMVDVFGNYVIQKFFEFGSLEQKLALAERIRGHVLSLALQMYGCRVIQKALEFIPSDQQNEMVRELDGHVLKCVKDQNGNHVVQKCIECVQPQSLQFIIDAFKGQVFALSTHPYGCRVIQRILEHCLPDQTLPILEELHQHTEQLVQDQYGNYVIQHVLEHGRPEDKSKIVAEIRGNVLVLSQHKFASNVVEKCVTHASRTERAVLIDEVCTMNDGPHSALYTMMKDQYANYVVQKMIDVAEPGQRKIVMHKIRPHIATLRKYTYGKHILAKLEKYYMKNGVDLGPICGPPNGII DIP protein Q14671 original sequence version: 54 E1E0D8B3B0181308 q09487_caeel puf-8 CELE_C30G12.7 C30G12.7 protein protein caeel Caenorhabditis elegans MSRPISIGNTCTFDPSASPIESLGRSIGAQKIVDSVCGSPIRSYGRHISTNPKNERLPDTPEFQFATYMHQGGKVIGQNTLHMFGTPPSCYCAQENIPISSNVGHVLSTINNNYMNHQYNGSNMFSNQMTQMLQAQAYNDLQMHQAHSQSIRVPVQPSATGIFSNPYREPTTTDDLLTRYRANPAMMKNLKLSDIRGALLKFAKDQVGSRFIQQELASSKDRFEKDSIFDEVVSNADELVDDIFGNYVVQKFFEYGEERHWARLVDAIIDRVPEYAFQMYACRVLQKALEKINEPLQIKILSQIRHVIHRCMKDQNGNHVVQKAIEKVSPQYVQFIVDTLLESSNTIYEMSVDPYGCRVVQRCLEHCSPSQTKPVIGQIHKRFDEIANNQYGNYVVQHVIEHGSEEDRMVIVTRVSNNLFEFATHKYSSNVIEKCLEQGAVYHKSMIVGAACHHQEGSVPIVVQMMKDQYANYVVQKMFDQVTSEQRRELILTVRPHIPVLRQFPHGKHILAKLEKYFQKPAVMSYPYQDMQGSH DIP protein Q09487 original sequence version: 43 4D08B683DF0568FD mpt5p-pop2p-1 7 21 unspecified role unspecified role prey prey T7 Tag T7 Tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait TAP Tag TAP Tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged full dna sequence full identification by DNA sequencing full dna sequence c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association pop2p-ccr4p-1 10 19 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 21 unspecified role unspecified role bait bait TAP Tag TAP Tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged full dna sequence full identification by DNA sequencing full dna sequence c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mpt5p-ccr4p-1 3 19 unspecified role unspecified role prey prey T7 Tag T7 Tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait TAP Tag TAP Tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged full dna sequence full identification by DNA sequencing full dna sequence c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mpt5p-dcp1p-1 13 16 unspecified role unspecified role prey prey T7 Tag T7 Tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait TAP Tag TAP Tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged full dna sequence full identification by DNA sequencing full dna sequence c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association mpt5p-dhh1p-1 15 22 unspecified role unspecified role prey prey T7 Tag T7 Tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait g g tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged full dna sequence full identification by DNA sequencing full dna sequence c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association puf_8-ccf_1-1 9 23 unspecified role unspecified role prey prey T7 Tag T7 Tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 25 unspecified role unspecified role bait bait 142-535 binding site 142-535 binding site sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli direct interaction direct interaction pum1-cnot8-1 4 20 unspecified role unspecified role prey prey T7 Tag T7 Tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 24 unspecified role unspecified role bait bait 828-1176 binding region 828-1176 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag full dna sequence full identification by DNA sequencing full dna sequence n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction mpt5p-pop2p-2 11 21 unspecified role unspecified role prey prey MBP Tag MBP Tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 17 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag full dna sequence full identification by DNA sequencing full dna sequence n-term range n-terminal range n-term range n-term range n-terminal range n-term range 126-626 binding region 126-626 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association puf_8-pop2p-1 6 25 unspecified role unspecified role bait bait 142-535 binding site 142-535 binding site sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag full dna sequence full identification by DNA sequencing full dna sequence n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey T7 Tag T7 Tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction pum1-pop2p-1 5 24 unspecified role unspecified role bait bait 828-1176 binding region 828-1176 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag full dna sequence full identification by DNA sequencing full dna sequence n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey T7 Tag T7 Tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction mpt5p-pop2p-3 2 21 unspecified role unspecified role prey prey g g t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 17 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag full dna sequence full identification by DNA sequencing full dna sequence n-term range n-terminal range n-term range n-term range n-terminal range n-term range 126-626 binding region 126-626 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli direct interaction direct interaction mpt5p-ccf_1-1 1 23 unspecified role unspecified role prey prey T7 Tag T7 Tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 17 unspecified role unspecified role bait bait 126-626 binding region 126-626 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag full dna sequence full identification by DNA sequencing full dna sequence n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction mpt5p-cnot8-1 14 20 unspecified role unspecified role prey prey T7 Tag T7 Tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 17 unspecified role unspecified role bait bait 126-626 binding region 126-626 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 126-626 binding region 126-626 binding region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag full dna sequence full identification by DNA sequencing full dna sequence n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction mpt5p-ccr4p-2 8 19 unspecified role unspecified role prey prey T7 Tag T7 Tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag full dna sequence full identification by DNA sequencing full dna sequence c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag full dna sequence full identification by DNA sequencing full dna sequence n-term range n-terminal range n-term range n-term range n-terminal range n-term range 126-626 binding region 126-626 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli physical association physical association puf4p-pop2p-1 12 18 unspecified role unspecified role bait bait 8 binding region 8 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag full dna sequence full identification by DNA sequencing full dna sequence n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 21 unspecified role unspecified role prey prey Tag Tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag full dna sequence full identification by DNA sequencing full dna sequence c-term range C-terminal range c-term range c-term range C-terminal range c-term range in vitro In vitro direct interaction direct interaction