DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Rounding up: Engineering 12-membered rings from the cyclic 11-mer TRAP. Rounding up: Engineering 12-membered rings from the cyclic 11-mer TRAP. Structure (London, England : 1993) 2006 imex curation Heddle JG., Yokoyama T., Yamashita I., Park SY., Tame JR. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Heddle JG., Yokoyama T., Yamashita I., Park SY., Tame JR. DIP original experiment: DIP-66291X Structure (London, England : 1993) 2006 IMEx Rounding up: Engineering 12-membered rings from the cyclic 11-mer TRAP. Rounding up: Engineering 12-membered rings from the cyclic 11-mer TRAP. Rounding up: Engineering 12-membered rings from the cyclic 11-mer TRAP. Structure (London, England : 1993) 2006 imex curation Heddle JG., Yokoyama T., Yamashita I., Park SY., Tame JR. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Heddle JG., Yokoyama T., Yamashita I., Park SY., Tame JR. DIP original experiment: DIP-66292X Structure (London, England : 1993) 2006 IMEx Rounding up: Engineering 12-membered rings from the cyclic 11-mer TRAP. mtrb_geose Transcription attenuation protein MtrB mtrB Trp RNA-binding attenuation protein Tryptophan RNA-binding attenuator protein protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MYTNSDFVVIKALEDGVNVIGLTRGADTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGKK DIP protein Q9X6J6 original sequence version: 36 DIP protein Q9X6J6 original sequence version: 58 mtrb-1 1 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction mtrb-2 2 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction