DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu A yeast assay probes the interaction between botulinum neurotoxin serotype B and its SNARE substrate. A yeast assay probes the interaction between botulinum neurotoxin serotype B and its SNARE substrate. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Fang H., Luo W., Henkel J., Barbieri J., Green N. Only protein-protein interactions in vitro In vitro protease assay protease assay weight by staining molecular weight estimation by staining weight by staining Fang H., Luo W., Henkel J., Barbieri J., Green N. DIP original experiment: DIP-262891X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx A yeast assay probes the interaction between botulinum neurotoxin serotype B and its SNARE substrate. vamp2_human Vesicle-associated membrane protein 2 Synaptobrevin-2 VAMP2 SYB2 protein protein human Homo sapiens Human MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST DIP protein P63027 original sequence version: 108 DIP protein P63027 original sequence version: 60 DIP protein P63027 original sequence version: 74 9CD679C4F6F1B5A8 bxb_clobk Botulinum neurotoxin type B botB Bontoxilysin-B CLD_A0068 protein protein clobk Clostridium botulinum (strain Okra / Type B1) MPVTINNFNYNDPIDNNNIIMMEPPFARGTGRYYKAFKITDRIWIIPERYTFGYKPEDFNKSSGIFNRDVCEYYDPDYLNTNDKKNIFLQTMIKLFNRIKSKPLGEKLLEMIINGIPYLGDRRVPLEEFNTNIASVTVNKLISNPGEVERKKGIFANLIIFGPGPVLNENETIDIGIQNHFASREGFGGIMQMKFCPEYVSVFNNVQENKGASIFNRRGYFSDPALILMHELIHVLHGLYGIKVDDLPIVPNEKKFFMQSTDAIQAEELYTFGGQDPSIITPSTDKSIYDKVLQNFRGIVDRLNKVLVCISDPNININIYKNKFKDKYKFVEDSEGKYSIDVESFDKLYKSLMFGFTETNIAENYKIKTRASYFSDSLPPVKIKNLLDNEIYTIEEGFNISDKDMEKEYRGQNKAINKQAYEEISKEHLAVYKIQMCKSVKAPGICIDVDNEDLFFIADKNSFSDDLSKNERIEYNTQSNYIENDFPINELILDTDLISKIELPSENTESLTDFNVDVPVYEKQPAIKKIFTDENTIFQYLYSQTFPLDIRDISLTSSFDDALLFSNKVYSFFSMDYIKTANKVVEAGLFAGWVKQIVNDFVIEANKSNTMDKIADISLIVPYIGLALNVGNETAKGNFENAFEIAGASILLEFIPELLIPVVGAFLLESYIDNKNKIIKTIDNALTKRNEKWSDMYGLIVAQWLSTVNTQFYTIKEGMYKALNYQAQALEEIIKYRYNIYSEKEKSNINIDFNDINSKLNEGINQAIDNINNFINGCSVSYLMKKMIPLAVEKLLDFDNTLKKNLLNYIDENKLYLIGSAEYEKSKVNKYLKTIMPFDLSIYTNDTILIEMFNKYNSEILNNIILNLRYKDNNLIDLSGYGAKVEVYDGVELNDKNQFKLTSSANSKIRVTQNQNIIFNSVFLDFSVSFWIRIPKYKNDGIQNYIHNEYTIINCMKNNSGWKISIRGNRIIWTLIDINGKTKSVFFEYNIREDISEYINRWFFVTITNNLNNAKIYINGKLESNTDIKDIREVIANGEIIFKLDGDIDRTQFIWMKYFSIFNTELSQSNIEERYKIQSYSEYLKDFWGNPLMYNKEYYMFNAGNKNSYIKLKKDSPVGEILTRSKYNQNSKYINYRDLYIGEKFIIRRKSNSQSINDDIVRKEDYIYLDFFNLNQEWRVYTYKYFKKEEEKLFLAPISDSDEFYNTIQIKEYDEQPTYSCQLLFKKDEESTDEIGLIGIHRFYESGIVFEEYKDYFCISKWYLKEVKRKPYNLKLGCNWQFIPKDEGWTE DIP protein B1INP5 original sequence version: 49 botb-vamp2-1 1 2 enzyme target enzyme target substrate substrate unspecified role unspecified role Region 1-96 Region 1-96 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P63027:p.Asp65Gly D65G mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain D G This feature has been corrected as a result of our quality control procedures. The original label was 'D65G'. Wed May 02 17:43:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp65gly' Tue Jun 30 15:44:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp65Gly' P63027:p.Gln71Arg Q71R mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain Q R This feature has been corrected as a result of our quality control procedures. The original label was 'Q71R'. Wed May 02 16:03:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln71arg' Tue Jun 30 19:06:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln71Arg' P63027:p.Ser75Phe S75F mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain S F This feature has been corrected as a result of our quality control procedures. The original label was 'S75F'. Wed May 02 18:00:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser75phe' Tue Jun 30 18:13:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser75Phe' ecolx Escherichia coli 3 enzyme enzyme unspecified role unspecified role Region 2-441 Region 2-441 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast protein cleavage protein cleavage