DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Juxtamembranous aspartic acid in Insig-1 and Insig-2 is required for cholesterol homeostasis. Juxtamembranous aspartic acid in Insig-1 and Insig-2 is required for cholesterol homeostasis. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Gong Y., Lee JN., Brown MS., Goldstein JL., Ye J. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Gong Y., Lee JN., Brown MS., Goldstein JL., Ye J. DIP original experiment: DIP-262857X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Juxtamembranous aspartic acid in Insig-1 and Insig-2 is required for cholesterol homeostasis. Juxtamembranous aspartic acid in Insig-1 and Insig-2 is required for cholesterol homeostasis. Juxtamembranous aspartic acid in Insig-1 and Insig-2 is required for cholesterol homeostasis. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Gong Y., Lee JN., Brown MS., Goldstein JL., Ye J. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Gong Y., Lee JN., Brown MS., Goldstein JL., Ye J. DIP original experiment: DIP-262855X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Juxtamembranous aspartic acid in Insig-1 and Insig-2 is required for cholesterol homeostasis. Juxtamembranous aspartic acid in Insig-1 and Insig-2 is required for cholesterol homeostasis. Juxtamembranous aspartic acid in Insig-1 and Insig-2 is required for cholesterol homeostasis. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Gong Y., Lee JN., Brown MS., Goldstein JL., Ye J. Only protein-protein interactions crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Gong Y., Lee JN., Brown MS., Goldstein JL., Ye J. DIP original experiment: DIP-262856X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Juxtamembranous aspartic acid in Insig-1 and Insig-2 is required for cholesterol homeostasis. scap_crigr Sterol regulatory element-binding protein cleavage-activating protein SCAP protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MTLTERLREKISQAFYNHGLLCASYPIPIILFTGLCILACCYPLLKLPLPGTGPVEFSTPVKDYSPPPVDSDHKQGEPSEQPEWYVGAPVAYIQQIFVKSSVSPWHKNLLAVDVFRLPLSRAFQLVEEIRNHVLRDSSGTKSLEEVCLQVTDLLPGLRKLRNLLPEHGCLLLSPGNFWQNDWERFHADPDIIGTIHQHEPKTLQTSATLKDLLFGVPGKYSGVSLYTRKRTVSYTITLVFQRYHAKFLSSLRARLMLLHPSPNCSLRAENLVHVHFKEEIGIAELIPLVTTYIILFAYIYFSTRKIDMVKSKWGLALAAVVTVLSSLLMSVGLCTLFGLTPTLNGGEIFPYLVVVIGLENVLVLTKSVVSTPVDLEVKLRIAQGLSSESWSIMKNVATELGIILIGYFTLVPAIQEFCLFAVVGLVSDFFLQMFFFTTVLSIDIRRMELADLNKRLPPESCLPSAKPVGRPARYERQLAVRPAMPHTITLQPSSFRNLRLPKRLRVIYFLARTRLAQRLIMAGTVVWIGILVYTDPAGLRTYLAAQVTEQSPLGEGSLGPMPVPSGVLPASRPDPAFSIFPPDAPKLPENQTVPGELPEHAAPAEGVHDSRAPEVTWGPEDEELWRRLSFRHWPTLFNYYNITLAKRYISLLPVIPVTLRLNPQEALEGRQPQDGRSAWAPPESLPAGLWEAGPKGPGGTQAHGDITLYKVAALGLAAGIVLVLLLLCLYRVLCPRNYGQPGGGAGRRRRGELPCDDYGYAPPETEIVPLVLRGHLMDIECLASDGMLLVSCCLAGQVCVWDAQTGDCLTRIPRPGSRRDSCGGGAFETQENWERLSDGGKTSPEEPGESPPLRHRPRGPPQPALFGDQPDLTCLIDTNFSVQLPPEPTQPEPRHRAGCGRARDSGYDFSRLVQRVYQEEGLAAVRMPALRPPSPGSPLPQASQEDGAAPEKGSPPLAWAPSTAGSIWSLELQGNLIVVGRSSGRLEVWDAIEGVLCCSNDEVSSGITALVFLDRRIVAARLNGSLDFFSLETHTSLSPLQFRGTPGRGSSPSSSVYSSSNTVACHLTHTVPCAHQKPITALRAAAGRLVTGSQDHTLRVFRLEDSCCLFTLQGHSGAITTVYIDQTMVLASGGQDGAICLWDVLTGSRVSHTFAHRGDVTSLTCTTSCVISSGLDDLINIWDRSTGIKLYSIQQDLGCGASLGVISDNLLVTGGQGCVSFWDLNYGDLLQTVYLGKNSEAQPARQILVLDNAAIVCNFGSELSLVYVPSVLEKLD DIP protein P97260 original sequence version: 107 DIP protein P97260 original sequence version: 103 A8693F7157FF5FFC vapa_human Vesicle-associated membrane protein-associated protein A VAPA VAP33 33 kDa VAMP-associated protein protein protein human Homo sapiens Human MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL DIP protein Q9P0L0 original sequence version: 136 DIP protein Q9P0L0 original sequence version: 130 68B603F3A9FA5475 o15503-1 Insulin-induced gene 1 protein INSIG1 protein protein human Homo sapiens Human MPRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLLQRSLVLFSVGVVLALVLNLLQIQRNVTLFPEEVIATIFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD DIP protein O15503-1 original sequence version: 123 vapb_human Vesicle-associated membrane protein-associated protein B/C VAPB UNQ484/PRO983 protein protein human Homo sapiens Human MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL DIP protein O95292 original sequence version: 141 22AEEF9EC7FC0B3F vapb-insig1-1 1 7 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 6 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association insig1-scap-1 2 4 unspecified role unspecified role prey prey crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 6 unspecified role unspecified role bait bait O15503-1:p.Asp205Ala D205A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D205A'. Wed May 02 15:11:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp205ala' Tue Jun 30 16:50:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp205Ala' Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association vapa-insig1-1 3 5 unspecified role unspecified role bait bait HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster 6 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster physical association physical association