DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. DIP original experiment: DIP-262835X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. DIP original experiment: DIP-262836X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. DIP original experiment: DIP-262834X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. DIP original experiment: DIP-262833X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lettau M., Qian J., Linkermann A., Latreille M., Larose L., Kabelitz D., Janssen O. DIP original experiment: DIP-262832X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse. tnfl6_human Tumor necrosis factor ligand superfamily member 6 Fas antigen ligand CD95L Apoptosis antigen ligand FASLG APT1LG1 FASL TNFSF6 CD95 ligand protein protein human Homo sapiens Human MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL DIP protein P48023 original sequence version: 165 DIP protein P48023-1 original sequence version: 126 DIP protein P48023-1 original sequence version: 130 DIP protein P48023 original sequence version: 152 A8A6EB358246E9BB p16333-1 Cytoplasmic protein NCK1 NCK1 NCK NCK adaptor protein 1 SH2/SH3 adaptor protein NCK-alpha protein protein human Homo sapiens Human MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS DIP protein P16333-1 original sequence version: 165 DIP protein P16333 original sequence version: 163 DIP protein P16333 original sequence version: 160 wasl_human Neural Wiskott-Aldrich syndrome protein WASL protein protein human Homo sapiens Human MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDEDDEEDFEDDDEWED DIP protein O00401 original sequence version: 55 DIP protein O00401 original sequence version: 147 DIP protein O00401 original sequence version: 150 DIP protein O00401 original sequence version: 136 DIP protein O00401 original sequence version: 138 DIP protein O00401 original sequence version: 125 DIP protein O00401 original sequence version: 112 DIP protein O00401 original sequence version: 126 B5895C6055E23049 nck1-faslg-1 5 7 unspecified role unspecified role bait bait Region 109-164 Region 109-164 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 193-251 Region 193-251 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P16333-1:p.[Trp38Lys;Trp143Lys;Trp229Lys] W38K/W143K/W229K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain W K certain certain sequence position certain certain certain sequence position certain W K certain certain sequence position certain certain certain sequence position certain W K This feature has been corrected as a result of our quality control procedures. The original label was 'W38K/W143K/W229K'. Wed May 02 14:32:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp38lys,trp143lys,trp229lys' Tue Jun 30 16:24:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp38Lys;Trp143Lys;Trp229Lys]' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 6 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role prey prey human Homo sapiens Human association association nck1-faslg-2 3 7 unspecified role unspecified role bait bait P16333-1:p.Trp143Lys W143K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain W K This feature has been corrected as a result of our quality control procedures. The original label was 'W143K'. Wed May 02 16:46:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp143lys' Tue Jun 30 18:32:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp143Lys' GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P16333-1:p.Trp229Lys W229K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain W K This feature has been corrected as a result of our quality control procedures. The original label was 'W229K'. Wed May 02 16:55:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp229lys' Tue Jun 30 18:35:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp229Lys' ecolx Escherichia coli 6 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association faslg-nck1-2 2 7 unspecified role unspecified role prey prey P16333-1:p.[Trp38Lys;Trp143Lys;Trp229Lys] W38K/W143K/W229K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain W K certain certain sequence position certain certain certain sequence position certain W K certain certain sequence position certain certain certain sequence position certain W K This feature has been corrected as a result of our quality control procedures. The original label was 'W38K/W143K/W229K'. Wed May 02 16:11:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp38lys,trp143lys,trp229lys' Tue Jun 30 16:58:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp38Lys;Trp143Lys;Trp229Lys]' Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 6 unspecified role unspecified role bait bait human Homo sapiens Human physical association physical association nck1-wasl-1 4 7 unspecified role unspecified role bait bait Region 5-60 Region 5-60 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 8 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association nck1-faslg-3 1 7 unspecified role unspecified role bait bait P16333-1:p.[Trp38Lys;Trp143Lys;Trp229Lys] W38K/W143K/W229K mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain W K certain certain sequence position certain certain certain sequence position certain W K certain certain sequence position certain certain certain sequence position certain W K This feature has been corrected as a result of our quality control procedures. The original label was 'W38K/W143K/W229K'. Wed May 02 15:16:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp38lys,trp143lys,trp229lys' Tue Jun 30 18:55:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp38Lys;Trp143Lys;Trp229Lys]' Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 6 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association