DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the MTIP-MyoA complex, a key component of the malaria parasite invasion motor. Structure of the MTIP-MyoA complex, a key component of the malaria parasite invasion motor. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Bosch J., Turley S., Daly TM., Bogh SM., Villasmil ML., Roach C., Zhou N., Morrisey JM., Vaidya AB., Bergman LW., Hol WG. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bosch J., Turley S., Daly TM., Bogh SM., Villasmil ML., Roach C., Zhou N., Morrisey JM., Vaidya AB., Bergman LW., Hol WG. DIP original experiment: DIP-262744X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structure of the MTIP-MyoA complex, a key component of the malaria parasite invasion motor. Structure of the MTIP-MyoA complex, a key component of the malaria parasite invasion motor. Structure of the MTIP-MyoA complex, a key component of the malaria parasite invasion motor. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Bosch J., Turley S., Daly TM., Bogh SM., Villasmil ML., Roach C., Zhou N., Morrisey JM., Vaidya AB., Bergman LW., Hol WG. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bosch J., Turley S., Daly TM., Bogh SM., Villasmil ML., Roach C., Zhou N., Morrisey JM., Vaidya AB., Bergman LW., Hol WG. DIP original experiment: DIP-262742X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structure of the MTIP-MyoA complex, a key component of the malaria parasite invasion motor. Structure of the MTIP-MyoA complex, a key component of the malaria parasite invasion motor. Structure of the MTIP-MyoA complex, a key component of the malaria parasite invasion motor. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Bosch J., Turley S., Daly TM., Bogh SM., Villasmil ML., Roach C., Zhou N., Morrisey JM., Vaidya AB., Bergman LW., Hol WG. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bosch J., Turley S., Daly TM., Bogh SM., Villasmil ML., Roach C., Zhou N., Morrisey JM., Vaidya AB., Bergman LW., Hol WG. DIP original experiment: DIP-262743X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structure of the MTIP-MyoA complex, a key component of the malaria parasite invasion motor. myoa_playo Myosin-A MyoA PY01232 protein protein playo Plasmodium yoelii yoelii MAVTNEELKTAHKIVRRVSNIEAFDKSGVVFKGYQIWTNISPTIEEDPNVMFVKCVVQHGSNQDKLNVVQIDPPGSGTPYEIDVKSAWNCNSQVDPMSFGDIGLLNHTNTPCVLDFLKHRYLKNQIYTTACPLIVAINPYKDLGNTTDEWIRKYRDASDHTRLPPHIFSCAREALSNLHGVNKSQTIIVSGESGAGKTEATKQIMKYFASSKNGNMDLYIQTAIMAANPVLEAFGNAKTIRNNNSSRFGRFMQLAISHEGGIRNGSVVAFLLEKSRIITQDDNERSYHIFYQFLKGADSNMKSKFGLKGIKDYKLLNPNSPDVDGIDDVKDFQEVITSLKNMQLNDEQIEVIFSIIAGILTLGNVRIVEKTEAGLSDAAGIHNDDMETFKKACELMFLDPELVKRELLIKVTIAGGNRIEGRWNKNDAEVLKLSLCKAMYEKLFLWIIKNLNSRIEPEGGFKAFMGMLDIFGFEVFKNNSLEQLFINITNEMLQKNFVDIVFERESKLYRDEGISTAELNYTSNKEVISVLCERGKSVLSYLEDQCLAPGGSDEKFVNACVVNLKSNEKFIPAKVASNKNFIIQHTIGPIQYCSDNFLLKNKDVLRGELVEIILGSGNKVVSGLFEGQVIEKGKMAKGSLIGSQFLNQLTSLMTLINSTEPHFIRCIKPNENKKPLEWCEPKILIQLHALSILEALVLRQLGYSYRRTFDEFLYQFKFVDINTSENSSLDSREKCNKILKLSGLSDDMLKIGKTMVFLKQDGAKMLSKIQREKLVEWENCVSVIEAAIMKYKHKQNVENNVSSLMRVQAHIRKRMVA DIP protein Q7RQ71 original sequence version: 61 d0vwv5_plakn protein protein plakn Plasmodium knowlesi KDMFNTKSSNGKLRIEDASHNARKLGLAPSSTDEKKIRDLYGDSLTYEQYLEYLTMCVHDRDNMEELIKMFSHFDNNSSGFLTKNQMKNILTTWGDALTEQEANDALNAFSSEDRINYKLFCEDIL DIP protein D0VWV5 original sequence version: 13 q7rsf0_playo Non-specific serine/threonine protein kinase PY00409 protein protein playo Plasmodium yoelii yoelii MEQQCHACYFELPDPKTTIGPYDSELNYFMWGPGFEWKPEPVVSQISGEDTYDETEESEESEHGFDELDEKVNKDDRKRYFDEKSSGGKISIENASHNARRLGLAPSSKDEEKIRELYGDNLTYDQYLEYLSMSIHDKDNAEQLVKMFAYFDTNTTGYLTKNQMKNILITWGDALTEDEAMNALNAFSNDDKIDYKLFCEDILQ DIP protein Q7RSF0 original sequence version: 54 d0vwv5_plakn-myoa_playo-1 2 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role Region 803-817 Region 803-817 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction myoa_playo-q7rsf0_playo-1 1 4 unspecified role unspecified role bait bait Region 803-817 Region 803-817 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey Q7RSF0:p.Phe148Ala F148A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F148A'. Wed May 02 18:50:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe148ala' Tue Jun 30 18:33:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe148Ala' Q7RSF0:p.[Ile167Ala;Leu168Ala] I167A/L168A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I167A/L168A'. Wed May 02 18:13:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile167ala,leu168ala' Tue Jun 30 17:05:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile167Ala;Leu168Ala]' Q7RSF0:p.Asp173Ala D173A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A This feature has been corrected as a result of our quality control procedures. The original label was 'D173A'. Wed May 02 19:03:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp173ala' Tue Jun 30 15:54:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp173Ala' Q7RSF0:p.Leu175Ala L175A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L175A'. Wed May 02 20:09:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu175ala' Tue Jun 30 20:13:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu175Ala' Q7RSF0:p.Phe198Ala F198A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain F A This feature has been corrected as a result of our quality control procedures. The original label was 'F198A'. Wed May 02 14:56:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe198ala' Tue Jun 30 19:06:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe198Ala' Q7RSF0:p.Trp171Ala W171A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain W A This feature has been corrected as a result of our quality control procedures. The original label was 'W171A'. Wed May 02 17:26:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp171ala' Tue Jun 30 16:47:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp171Ala' Q7RSF0:p.[Glu200Ala;Asp201Ala] E200A/D201A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E200A/D201A'. Wed May 02 18:42:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu200ala,asp201ala' Tue Jun 30 19:12:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu200Ala;Asp201Ala]' Q7RSF0:p.Glu179Ala E179A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A This feature has been corrected as a result of our quality control procedures. The original label was 'E179A'. Wed May 02 19:34:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu179ala' Tue Jun 30 16:07:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu179Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association myoa_playo-q7rsf0_playo-2 3 4 unspecified role unspecified role bait bait Region 803-817 Region 803-817 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q7RQ71:p.Leu804Ala L804A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A This feature has been corrected as a result of our quality control procedures. The original label was 'L804A'. Wed May 02 16:11:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu804ala' Tue Jun 30 17:32:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu804Ala' Q7RQ71:p.Val807Ala V807A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V807A'. Wed May 02 15:04:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val807ala' Tue Jun 30 17:02:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val807Ala' Q7RQ71:p.Ile811Ala I811A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain I A This feature has been corrected as a result of our quality control procedures. The original label was 'I811A'. Wed May 02 16:21:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile811ala' Tue Jun 30 17:23:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile811Ala' Q7RQ71:p.Arg812Ala R812A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R812A'. Wed May 02 14:33:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg812ala' Tue Jun 30 19:55:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg812Ala' Q7RQ71:p.Arg814Ala R814A mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R814A'. Wed May 02 15:32:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg814ala' Tue Jun 30 19:27:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg814Ala' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association