DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Mechanism of substrate specificity in Bacillus subtilis ResA, a thioredoxin-like protein involved in cytochrome c maturation. Mechanism of substrate specificity in Bacillus subtilis ResA, a thioredoxin-like protein involved in cytochrome c maturation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Colbert CL., Wu Q., Erbel PJ., Gardner KH., Deisenhofer J. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Colbert CL., Wu Q., Erbel PJ., Gardner KH., Deisenhofer J. DIP original experiment: DIP-262701X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Mechanism of substrate specificity in Bacillus subtilis ResA, a thioredoxin-like protein involved in cytochrome c maturation. Mechanism of substrate specificity in Bacillus subtilis ResA, a thioredoxin-like protein involved in cytochrome c maturation. Mechanism of substrate specificity in Bacillus subtilis ResA, a thioredoxin-like protein involved in cytochrome c maturation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Colbert CL., Wu Q., Erbel PJ., Gardner KH., Deisenhofer J. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Colbert CL., Wu Q., Erbel PJ., Gardner KH., Deisenhofer J. DIP original experiment: DIP-262700X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Mechanism of substrate specificity in Bacillus subtilis ResA, a thioredoxin-like protein involved in cytochrome c maturation. resa_bacsu Thiol-disulfide oxidoreductase ResA resA ypxA BSU23150 protein protein bacsu Bacillus subtilis MKKKRRLFIRTGILLVLICALGYTIYNAVFAGKESISEGSDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMIHDYMNLIKPGETSG DIP protein P35160 original sequence version: 116 c550_bacsu Cytochrome c-550 cccA Cytochrome c A BSU25190 protein protein bacsu Bacillus subtilis MKWNPLIPFLLIAVLGIGLTFFLSVKGLDDSREIASGGESKSAEKKDANASPEEIYKANCIACHGENYEGVSGPSLKGVGDKKDVAEIKTKIEKGGNGMPSGLVPADKLDDMAEWVSKIK DIP protein P24469 original sequence version: 120 ccca-resa-1 2 3 unspecified role unspecified role unspecified role unspecified role Region 37-179 Region 37-179 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role Region 53-73 Region 53-73 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction ccca-resa-2 1 3 unspecified role unspecified role unspecified role unspecified role Region 37-179 Region 37-179 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role unspecified role unspecified role Region 53-73 Region 53-73 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction