DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66427X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66434X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66425X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66438X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66441X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66446X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66436X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66423X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66437X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66439X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66431X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66432X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66445X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66444X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66428X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66442X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66426X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66430X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66424X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66435X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions mouse Mus musculus Mouse anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66440X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66429X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66433X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. IAN family critically regulates survival and development of T lymphocytes. PLoS biology 2006 imex curation Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. Only protein-protein interactions mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Nitta T., Nasreen M., Seike T., Goji A., Ohigashi I., Miyazaki T., Ohta T., Kanno M., Takahama Y. DIP original experiment: DIP-66443X PLoS biology 2006 IMEx IAN family critically regulates survival and development of T lymphocytes. bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 gima4_mouse GTPase IMAP family member 4 Gimap4 Ian1 Imap4 Immunity-associated protein 4 Immunity-associated nucleotide 1 protein protein protein mouse Mus musculus Mouse MEVQCGGAGFIPESSRSSHELGNQDQGIPQLRIVLLGKTGAGKSSTGNSILGEKVFNSGICAKSITKVCEKRVSTWDGKELVVVDTPGIFDTEVPDADTQREITRYVALTSPGPHALLLVVPLGRYTVEEHKATQKILDMFGKQARRFMILLLTRKDDLEDTDIHEYLEKAPKFFQEVMHEFQNRYCLFNNRASGAEKEEQKMQLLTLVQSMVRENGGRCFTNKMYESAECVIQKETLRMQELYREELEREKARIRREYEEQIKDLRDELEREIRRARMEREFKEREAIFTKNQQNARKEVENTSMILELIIKAWEIASFIFNQFMKD mint Exhibits intrisinic GTPase activity. Shows a higher affinity for GDP over GTP (about 12-fold higher), and binding shows an absolute requirement for magnesium 10C2446CD3A2D7A7 bcl2_mouse Apoptosis regulator Bcl-2 Bcl2 Bcl-2 protein protein mouse Mus musculus Mouse MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10417 original sequence version: 71 DIP protein P10417 original sequence version: 126 80FDCFE78C735092 q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE gima3_mouse GTPase IMAP family member 3 Gimap3 Ian4 Immunity-associated nucleotide 4 protein protein protein mouse Mus musculus Mouse METLQNVVTGGKKGGCTSGSRPLRILLVGKSGCGKSATGNSLLRRPAFESRLRGQSVTRTSQAETGTWEGRSILVVDTPPIFESKAQNQDMDKDIGDCYLLCAPGPHVLLLVTQLGRFTAEDVMAVRMVKEVFGVGVMRHMIVLFTRKEDLAEKSLEEFVTHTDNRSLRSLVQECGRRYCAFNNRASGEEQQGQLAELMALVRRLEQECEGSFHSNDLFLHAETLLREGYSVHQEAYRCYLAKVRQEVEKQRWELEEQEGSWVLKVLPIGKKLEVLHSDFCWYLVLAILIFFVFFFLLFYV DIP protein Q99MI6 original sequence version: 34 bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS DIP protein Q16611 original sequence version: 74 DIP protein Q16611 original sequence version: 162 DIP protein Q16611 original sequence version: 97 DIP protein Q16611 original sequence version: 158 DIP protein Q16611 original sequence version: 151 DIP protein Q16611-1 original sequence version: 178 DIP protein Q16611-1 original sequence version: 180 DIP protein Q16611 original sequence version: 121 A2200FE72A46D04E bad_human Bcl2-associated agonist of cell death Bcl-2-binding component 6 Bcl-2-like protein 8 BAD BBC6 BCL2L8 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein human Homo sapiens Human MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ DIP protein Q92934 original sequence version: 66 DIP protein Q92934 original sequence version: 121 69FD8D27DDEE3241 b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH DIP protein O43521 original sequence version: 48 DIP protein O43521-1 original sequence version: 71 DIP protein O43521 original sequence version: 132 DIP protein O43521 original sequence version: 143 D75735E469CA6997 gima5_mouse GTPase IMAP family member 5 Gimap5 Ian4l1 Imap3 Immunity-associated nucleotide 4-like 1 protein Immunity-associated protein 3 GTPase of the immunity-associated protein 5 Ian5 protein protein mouse Mus musculus Mouse MEHLQKSTYGTIVQGPEAHCVQESSCLRILLVGKSGCGKSATGNSILRRPAFQSRLRGQSVTRTSQAETGTWEGRSILVVDTPPIFESKAQNQDMDKDIGDCYLLCAPGPHVLLLVTQLGRFTAEDAMAVRMVKEVFGVGVMRHMIVLFTRKEDLEEKSLEEFVTHTDNRSLRSLTQECGRRYCAFNNRASGEEQQGQLAELMALVRRLEQECEGSFHSNDLFLHAEALLREGYSVHQEAYRCYLAKVRQEVEKQRRELEEQEGSWIAKMICTVKSCWSSHTAACALLIVLGLTLLTTFINLCISRCK DIP protein Q8BWF2 original sequence version: 32 gimap3-bcl2-1 8 29 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 27 unspecified role unspecified role prey prey human Homo sapiens Human direct interaction direct interaction gimap5-bcl2-1 19 33 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 27 unspecified role unspecified role prey prey human Homo sapiens Human direct interaction direct interaction gimap3-bcl2l1-1 3 28 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human direct interaction direct interaction gimap5-bcl2l1-1 17 28 unspecified role unspecified role prey prey human Homo sapiens Human 33 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human direct interaction direct interaction gimap3-bax-1 1 25 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 29 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human direct interaction direct interaction gimap5-bax-1 15 25 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 33 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human direct interaction direct interaction ian1-bax-1 22 26 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 25 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human direct interaction direct interaction gimap3-bak1-1 18 30 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 29 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human direct interaction direct interaction gimap5-bak1-1 11 30 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 33 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human direct interaction direct interaction gimap3-bad-1 12 31 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 29 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human direct interaction direct interaction gimap5-bad-1 23 31 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human 33 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human direct interaction direct interaction gimap3-bcl2l11-1 2 32 unspecified role unspecified role prey prey human Homo sapiens Human 29 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human direct interaction direct interaction gimap5-bcl2l11-1 20 32 unspecified role unspecified role prey prey human Homo sapiens Human 33 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human direct interaction direct interaction gimap3-bcl2-2 7 29 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 27 unspecified role unspecified role prey prey mouse Mus musculus Mouse direct interaction direct interaction gimap5-bcl2-2 9 33 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 27 unspecified role unspecified role prey prey mouse Mus musculus Mouse direct interaction direct interaction gimap3-bcl2l1-2 4 28 unspecified role unspecified role prey prey mouse Mus musculus Mouse 29 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse direct interaction direct interaction gimap5-bcl2l1-2 10 28 unspecified role unspecified role prey prey mouse Mus musculus Mouse 33 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse direct interaction direct interaction gimap3-bax-2 21 25 unspecified role unspecified role prey prey mouse Mus musculus Mouse 29 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse direct interaction direct interaction gimap5-bax-2 5 25 unspecified role unspecified role prey prey mouse Mus musculus Mouse 33 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human direct interaction direct interaction bcl2-gimap3-1 16 29 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 27 unspecified role unspecified role bait bait mouse Mus musculus Mouse direct interaction direct interaction bcl2-gimap5-1 24 33 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse 27 unspecified role unspecified role bait bait mouse Mus musculus Mouse direct interaction direct interaction bcl2l1-gimap3-1 14 28 unspecified role unspecified role bait bait mouse Mus musculus Mouse 29 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse direct interaction direct interaction bcl2l1-gimap5-1 13 28 unspecified role unspecified role bait bait mouse Mus musculus Mouse 33 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range mouse Mus musculus Mouse direct interaction direct interaction gimap3-bcl2-3 6 29 unspecified role unspecified role bait bait mouse Mus musculus Mouse 27 unspecified role unspecified role prey prey mouse Mus musculus Mouse direct interaction direct interaction