DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Recognition of helical kinks by xeroderma pigmentosum group A protein triggers DNA excision repair. Recognition of helical kinks by xeroderma pigmentosum group A protein triggers DNA excision repair. Nature structural & molecular biology 2006 imex curation Camenisch U., Dip R., Schumacher SB., Schuler B., Naegeli H. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Camenisch U., Dip R., Schumacher SB., Schuler B., Naegeli H. DIP original experiment: DIP-66177X Nature structural & molecular biology 2006 IMEx Recognition of helical kinks by xeroderma pigmentosum group A protein triggers DNA excision repair. ercc1_human DNA excision repair protein ERCC-1 ERCC1 protein protein human Homo sapiens Human MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP DIP protein P07992 original sequence version: 109 DIP protein P07992 original sequence version: 69 DIP protein P07992 original sequence version: 162 6FCE3615732349E5 xpa_human DNA repair protein complementing XP-A cells XPA XPAC Xeroderma pigmentosum group A-complementing protein protein protein human Homo sapiens Human MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM DIP protein P23025 original sequence version: 75 DIP protein P23025 original sequence version: 116 F89F735219A8494B xpa-ercc1-3 1 2 unspecified role unspecified role prey prey His6 Tag His6 Tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag full dna sequence full identification by DNA sequencing full dna sequence n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 3 unspecified role unspecified role bait bait GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association