DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The antioxidant protein alkylhydroperoxide reductase of Helicobacter pylori switches from a peroxide reductase to a molecular chaperone function. The antioxidant protein alkylhydroperoxide reductase of Helicobacter pylori switches from a peroxide reductase to a molecular chaperone function. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Chuang MH., Wu MS., Lo WL., Lin JT., Wong CH., Chiou SH. Only protein-protein interactions ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Chuang MH., Wu MS., Lo WL., Lin JT., Wong CH., Chiou SH. DIP original experiment: DIP-262629X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The antioxidant protein alkylhydroperoxide reductase of Helicobacter pylori switches from a peroxide reductase to a molecular chaperone function. The antioxidant protein alkylhydroperoxide reductase of Helicobacter pylori switches from a peroxide reductase to a molecular chaperone function. The antioxidant protein alkylhydroperoxide reductase of Helicobacter pylori switches from a peroxide reductase to a molecular chaperone function. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Chuang MH., Wu MS., Lo WL., Lin JT., Wong CH., Chiou SH. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Chuang MH., Wu MS., Lo WL., Lin JT., Wong CH., Chiou SH. DIP original experiment: DIP-262630X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The antioxidant protein alkylhydroperoxide reductase of Helicobacter pylori switches from a peroxide reductase to a molecular chaperone function. The antioxidant protein alkylhydroperoxide reductase of Helicobacter pylori switches from a peroxide reductase to a molecular chaperone function. The antioxidant protein alkylhydroperoxide reductase of Helicobacter pylori switches from a peroxide reductase to a molecular chaperone function. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Chuang MH., Wu MS., Lo WL., Lin JT., Wong CH., Chiou SH. Only protein-protein interactions ecolx Escherichia coli tem transmission electron microscopy tem predetermined predetermined participant predetermined Chuang MH., Wu MS., Lo WL., Lin JT., Wong CH., Chiou SH. DIP original experiment: DIP-262628X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The antioxidant protein alkylhydroperoxide reductase of Helicobacter pylori switches from a peroxide reductase to a molecular chaperone function. The antioxidant protein alkylhydroperoxide reductase of Helicobacter pylori switches from a peroxide reductase to a molecular chaperone function. The antioxidant protein alkylhydroperoxide reductase of Helicobacter pylori switches from a peroxide reductase to a molecular chaperone function. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Chuang MH., Wu MS., Lo WL., Lin JT., Wong CH., Chiou SH. Only protein-protein interactions ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Chuang MH., Wu MS., Lo WL., Lin JT., Wong CH., Chiou SH. DIP original experiment: DIP-262627X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx The antioxidant protein alkylhydroperoxide reductase of Helicobacter pylori switches from a peroxide reductase to a molecular chaperone function. q5uc28_helpx Alkyl hydroperoxide reductase C EC550_01870 EC572_01165 HPF17_1489 HPF20_1483 HPF38_1541 HPF63_1493 HPF72_1532 HPF94_1489 HPMKM1_1497 HPMKM6_1491 C2S07_00800 tsaA ahpC AC783_03760 AV921_0201575 JM68_00925 Peroxiredoxin Thioredoxin peroxidase protein protein helpx Helicobacter pylori Campylobacter pylori MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL 2DCE9F9F8AA6BCE0 q5fzj0_helpx Alkyl hydroperoxide reductase C ahpC Peroxiredoxin Thioredoxin peroxidase protein protein helpx Helicobacter pylori Campylobacter pylori MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFHEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPVVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL 5ADB9EDA9EF7F9E1 hc28ahpc-1 4 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction hc28ahpc-2 3 5 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction hd30ahpc-1 1 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction hd30ahpc-2 2 6 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction