DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Crystal structure of the IL-2 signaling complex: paradigm for a heterotrimeric cytokine receptor. Crystal structure of the IL-2 signaling complex: paradigm for a heterotrimeric cytokine receptor. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Stauber DJ., Debler EW., Horton PA., Smith KA., Wilson IA. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Stauber DJ., Debler EW., Horton PA., Smith KA., Wilson IA. DIP original experiment: DIP-262588X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of the IL-2 signaling complex: paradigm for a heterotrimeric cytokine receptor. Crystal structure of the IL-2 signaling complex: paradigm for a heterotrimeric cytokine receptor. Crystal structure of the IL-2 signaling complex: paradigm for a heterotrimeric cytokine receptor. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Stauber DJ., Debler EW., Horton PA., Smith KA., Wilson IA. Only protein-protein interactions trini Trichoplusia ni (Cabbage looper) Cabbage looper molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Stauber DJ., Debler EW., Horton PA., Smith KA., Wilson IA. DIP original experiment: DIP-262586X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of the IL-2 signaling complex: paradigm for a heterotrimeric cytokine receptor. Crystal structure of the IL-2 signaling complex: paradigm for a heterotrimeric cytokine receptor. Crystal structure of the IL-2 signaling complex: paradigm for a heterotrimeric cytokine receptor. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Stauber DJ., Debler EW., Horton PA., Smith KA., Wilson IA. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Stauber DJ., Debler EW., Horton PA., Smith KA., Wilson IA. DIP original experiment: DIP-262587X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Crystal structure of the IL-2 signaling complex: paradigm for a heterotrimeric cytokine receptor. il2rb_human Interleukin-2 receptor subunit beta IL2RB High affinity IL-2 receptor subunit beta p70-75 Interleukin-15 receptor subunit beta IL15RB protein protein human Homo sapiens Human MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDTIPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDVQKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFTNQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCTFPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVPDLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQELQGQDPTHLV DIP protein P14784 original sequence version: 170 DIP protein P14784 original sequence version: 147 1A76FA1936BB7EE6 p31785-1 Cytokine receptor common subunit gamma IL2RG Interleukin-2 receptor subunit gamma gammaC p64 protein protein human Homo sapiens Human MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET DIP protein P31785-1 original sequence version: 174 DIP protein P31785 original sequence version: 147 il2ra_human Interleukin-2 receptor subunit alpha IL2RA TAC antigen p55 protein protein human Homo sapiens Human MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQVAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI DIP protein P01589 original sequence version: 162 DIP protein P01589 original sequence version: 165 mint 83D907C8C81D2C0E il2_human Interleukin-2 T-cell growth factor IL2 protein protein human Homo sapiens Human MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFCQSIISTLT DIP protein P60568 original sequence version: 128 DIP protein P60568 original sequence version: 131 DIP protein P60568 original sequence version: 104 59E2F40F25860F84 il2rg-5 2 5 unspecified role unspecified role unspecified role unspecified role Region 23-255 Region 23-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper direct interaction direct interaction il2-il2ra-1 1 6 unspecified role unspecified role unspecified role unspecified role Region 22-233 Region 22-233 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 7 unspecified role unspecified role unspecified role unspecified role Region 21-153 Region 21-153 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 4 unspecified role unspecified role unspecified role unspecified role Region 27-232 Region 27-232 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 5 unspecified role unspecified role unspecified role unspecified role Region 23-255 Region 23-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association il2-il2ra-2 3 6 unspecified role unspecified role unspecified role unspecified role Region 22-233 Region 22-233 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 7 unspecified role unspecified role unspecified role unspecified role Region 21-153 Region 21-153 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 4 unspecified role unspecified role unspecified role unspecified role Region 27-232 Region 27-232 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper 5 unspecified role unspecified role unspecified role unspecified role Region 23-255 Region 23-255 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini Trichoplusia ni (Cabbage looper) Cabbage looper physical association physical association