DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. DIP original experiment: DIP-262570X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. DIP original experiment: DIP-262568X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. DIP original experiment: DIP-262571X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. Only protein-protein interactions chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. DIP original experiment: DIP-262569X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. DIP original experiment: DIP-262572X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. Only protein-protein interactions in vitro In vitro pull down pull down autoradiography autoradiography Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. DIP original experiment: DIP-262573X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Burd CJ., Petre CE., Morey LM., Wang Y., Revelo MP., Haiman CA., Lu S., Fenoglio-Preiser CM., Li J., Knudsen ES., Wong J., Knudsen KE. DIP original experiment: DIP-262567X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Cyclin D1b variant influences prostate cancer growth through aberrant androgen receptor regulation. hdac3_human Histone deacetylase 3 HDAC3 RPD3-2 SMAP45 protein protein human Homo sapiens Human MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI DIP protein O15379 original sequence version: 159 DIP protein O15379 original sequence version: 161 DIP protein O15379 original sequence version: 162 DIP protein O15379 original sequence version: 89 DIP protein O15379 original sequence version: 156 DIP protein O15379 original sequence version: 176 DIP protein O15379 original sequence version: 170 DIP protein O15379-1 original sequence version: 170 DIP protein O15379 original sequence version: 127 DIP protein O15379-1 original sequence version: 128 DIP protein O15379 original sequence version: 119 94485C1EBDCF5AD0 andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ DIP protein P10275 original sequence version: 220 DIP protein P10275-1 original sequence version: 213 DIP protein P10275 original sequence version: 216 DIP protein P10275 original sequence version: 143 DIP protein P10275 original sequence version: 174 DIP protein P10275 original sequence version: 169 DIP protein P10275 original sequence version: 188 DIP protein P10275-1 original sequence version: 188 DIP protein P10275 original sequence version: 196 DIP protein P10275 original sequence version: 217 DIP protein P10275-1 original sequence version: 217 DIP protein P10275-1 original sequence version: 207 A73432C55D39AE06 ccnd1_human G1/S-specific cyclin-D1 CCND1 BCL1 PRAD1 PRAD1 oncogene BCL-1 oncogene B-cell lymphoma 1 protein protein protein human Homo sapiens Human MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI DIP protein P24385 original sequence version: 163 DIP protein P24385 original sequence version: 165 DIP protein P24385 original sequence version: 160 DIP protein P24385 original sequence version: 121 DIP protein P24385 original sequence version: 122 DIP protein P24385 original sequence version: 143 DIP protein P24385 original sequence version: 127 3CC00C9905F58D3A ccnd1-ar-1 7 10 unspecified role unspecified role bait bait human Homo sapiens Human 9 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association ccnd1-ar-2 1 9 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 10 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association ccnd1-ar-3 6 9 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 10 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction ccnd1-hdac3-1 2 8 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 10 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association ar-ccnd1-1 3 9 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 10 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association hdac3-ccnd1-1 4 8 unspecified role unspecified role bait bait chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey 10 unspecified role unspecified role prey prey chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey physical association physical association ccnd1-hdac3-2 5 8 unspecified role unspecified role prey prey 35S-label 35S-label 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 10 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli direct interaction direct interaction