DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target. Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Bewley MC., Graziano V., Jiang J., Matz E., Studier FW., Pegg AE., Coleman CS., Flanagan JM. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Bewley MC., Graziano V., Jiang J., Matz E., Studier FW., Pegg AE., Coleman CS., Flanagan JM. DIP original experiment: DIP-262553X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target. Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target. Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target. Proceedings of the National Academy of Sciences of the United States of America 2006 imex curation Bewley MC., Graziano V., Jiang J., Matz E., Studier FW., Pegg AE., Coleman CS., Flanagan JM. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bewley MC., Graziano V., Jiang J., Matz E., Studier FW., Pegg AE., Coleman CS., Flanagan JM. DIP original experiment: DIP-262554X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target. sat1_human Diamine acetyltransferase 1 SAT1 Spermidine/spermine N(1)-acetyltransferase 1 Putrescine acetyltransferase Polyamine N-acetyltransferase 1 SAT protein protein human Homo sapiens Human MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE DIP protein P21673 original sequence version: 148 6A0578B88CD72F09 sat1-1 1 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction sat1-2 2 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction