DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Structure of the cyclic-AMP-responsive exchange factor Epac2 in its auto-inhibited state. Structure of the cyclic-AMP-responsive exchange factor Epac2 in its auto-inhibited state. Nature 2006 imex curation Rehmann H., Das J., Knipscheer P., Wittinghofer A., Bos JL. Only protein-protein interactions in vitro In vitro gdp_gtp exchange gdp/gtp exchange assay gtp/gdp exchange guanine nucleotide exchange assay gtp/gdp exchange guanine nucleotide exchange assay gdp_gtp exchange predetermined predetermined participant predetermined Rehmann H., Das J., Knipscheer P., Wittinghofer A., Bos JL. DIP original experiment: DIP-253739X Nature 2006 IMEx Structure of the cyclic-AMP-responsive exchange factor Epac2 in its auto-inhibited state. q9eqz6-3 Rap guanine nucleotide exchange factor 4 Rapgef4 Cgef2 Epac2 Exchange factor directly activated by cAMP 2 Exchange protein directly activated by cAMP 2 cAMP-dependent Rap1 guanine-nucleotide exchange factor cAMP-regulated guanine nucleotide exchange factor II protein protein mouse Mus musculus Mouse MVAAHAAHSQSSAEWIACLDKRPLERSSEDVDIIFTRLKGVKAFEKFHPNLLRQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIGTAFGESILDNTPRHATIVTRESSELLRIEQEDFKALWEKYRQYMAGLLAPPYGVMETGSNNDRIPDKENVPSEKILRAGKILRIAILSRAPHMIRDRKYHLKTYRQCCVGTELVDWMIQQTSCVHSRTQAVGMWQVLLEDGVLNHVDQERHFQDKYLFYRFLDDEREDAPLPTEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDDLEIIYDELLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGNRAANQGNSQPQQKYTVMSGTPEKILEHFLETIRLEPSLNEATDSVLNDFVMMHCVFMPNTQLCPALVAHYHAQPSQGTEQERMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVAMAFLEEFYVSVSDDARMMAAFKEQLPELEKIVKQISEDAKAPQKKHKVLLQQFNTGDERAQKRQPIRGSDEVLFKVYCIDHTYTTIRVPVAASVKEVISAVADKLGSGEGLIIVKMNSGGEKVVLKSNDVSVFTTLTINGRLFACPREQFDSLTPLPEQEGPTTGTVGTFELMSSKDLAYQMTTYDWELFNCVHELELIYHTFGRHNFKKTTANLDLFLRRFNEIQFWVVTEVCLCSQLSKRVQLLKKFIKIAAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLMDPSRNHRAYRLTAAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEKMRMIANTARTVRYYRSQPFNPDAAQANKNHQDVRSYVRQLNVIDNQRTLSQMSHRLEPRRP DIP protein Q9EQZ6-3 original sequence version: 116 DIP protein Q9EQZ6-3 original sequence version: 67 Produced by alternative splicing of isoform 1. No experimental confirmation available. rap1b_human Ras-related protein Rap-1b OK/SW-cl.11 RAP1B GTP-binding protein smg p21B protein protein human Homo sapiens Human MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSCQLL DIP protein P61224 original sequence version: 116 DIP protein P61224 original sequence version: 107 CE976895E5965224 rap1b-rapgef4-1 1 3 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli 2 unspecified role unspecified role unspecified role unspecified role Region 309-993 Region 309-993 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9EQZ6-3:p.Arg886Ala R886A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A This feature has been corrected as a result of our quality control procedures. The original label was 'R886A'. Wed May 02 20:28:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg886ala' Tue Jun 30 18:47:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg886Ala' Q9EQZ6-3:p.His452Ala H452A mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain H A This feature has been corrected as a result of our quality control procedures. The original label was 'H452A'. Wed May 02 18:35:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his452ala' Tue Jun 30 19:01:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His452Ala' ecolx Escherichia coli direct interaction direct interaction