DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. Nature structural & molecular biology 2006 imex curation Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. DIP original experiment: DIP-66093X Nature structural & molecular biology 2006 IMEx The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. Nature structural & molecular biology 2006 imex curation Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. DIP original experiment: DIP-66091X Nature structural & molecular biology 2006 IMEx The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. Nature structural & molecular biology 2006 imex curation Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. DIP original experiment: DIP-66094X Nature structural & molecular biology 2006 IMEx The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. Nature structural & molecular biology 2006 imex curation Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. Only protein-protein interactions human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. DIP original experiment: DIP-66092X Nature structural & molecular biology 2006 IMEx The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. Nature structural & molecular biology 2006 imex curation Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip protein sequence protein sequence identification protein sequence Masters SL., Yao S., Willson TA., Zhang JG., Palmer KR., Smith BJ., Babon JJ., Nicola NA., Norton RS., Nicholson SE. DIP original experiment: DIP-66090X Nature structural & molecular biology 2006 IMEx The SPRY domain of SSB-2 adopts a novel fold that presents conserved Par-4-binding residues. spsb4_mouse SPRY domain-containing SOCS box protein 4 Spsb4 Ssb4 protein protein mouse Mus musculus Mouse MGQKLSGSLKSVEVREPALRPAKRELRGLEPGRPARLDQLLDMPAAGLAVQLRHAWNPEDRSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQIHWPARQRGTHAVVGVATARAPLHSVGYTALVGSDSESWGWDLGRSRLYHDGKNRPGVAYPAFLGPDEAFALPDSLLVVLDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDLCRRSIRSALGRQRLRDIGSLPLPQSLKNYLQYQ DIP protein Q8R5B6 original sequence version: 33 623749B6F8C31B22 spsb1_mouse SPRY domain-containing SOCS box protein 1 Spsb1 Ssb1 protein protein mouse Mus musculus Mouse MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGKERLGAIPALPLPASLKAYLLYQ DIP protein Q9D5L7 original sequence version: 38 2CBA3B50A3240177 spsb2_mouse SPRY domain-containing SOCS box protein 2 Spsb2 Grcc9 Ssb2 Gene-rich cluster protein C9 protein protein mouse Mus musculus Mouse MGQTALARGSSSTPTSQALYSDFSPPEGLEELLSAPPPDLVAQRHHGWNPKDCSENIDVKEGGLCFERRPVAQSTDGVRGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQADHYAALLGSNSESWGWDIGRGKLYHQSKGLEAPQYPAGPQGEQLVVPERLLVVLDMEEGTLGYSIGGTYLGPAFRGLKGRTLYPSVSAVWGQCQVRIRYMGERRVEEPQSLLHLSRLCVRHALGDTRLGQISTLPLPPAMKRYLLYK DIP protein O88838 original sequence version: 41 E71985597D9B38CB met_human Hepatocyte growth factor receptor MET Scatter factor receptor HGF/SF receptor Tyrosine-protein kinase Met Proto-oncogene c-Met protein protein human Homo sapiens Human MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDLLKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPASFWETS DIP protein P08581 original sequence version: 94 DIP protein P08581 original sequence version: 200 DIP protein P08581 original sequence version: 128 DIP protein P08581-1 original sequence version: 166 DIP protein P08581 original sequence version: 211 9CF896D1273905C3 pawr_human PRKC apoptosis WT1 regulator protein Prostate apoptosis response 4 protein PAWR PAR4 protein protein human Homo sapiens Human MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR DIP protein Q96IZ0 original sequence version: 31 DIP protein Q96IZ0 original sequence version: 110 7E7515455402DBF8 spsb2-pawr-1 5 8 unspecified role unspecified role bait bait 1-221 binding region 1-221 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role prey prey mouse Mus musculus Mouse physical association physical association spsb1-pawr-1 2 10 unspecified role unspecified role prey prey human Homo sapiens Human 7 unspecified role unspecified role bait bait 1-231 1-231 sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association spsb4-pawr-1 4 10 unspecified role unspecified role prey prey human Homo sapiens Human 6 unspecified role unspecified role bait bait 1-233 binding site 1-233 binding site sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain human Homo sapiens Human physical association physical association spsb2-pawr-2 1 10 unspecified role unspecified role prey prey human Homo sapiens Human 8 unspecified role unspecified role bait bait 1-221 binding region 1-221 binding region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain O88838:p.Tyr120Ala Y120A mutation mutation disrupting mutation disrupting interaction mutation disrupting full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain Y A This feature has been corrected as a result of our quality control procedures. The original label was 'Y120A mutation'. Wed May 02 16:55:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr120ala' Tue Jun 30 16:16:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr120Ala' O88838:p.Leu123_Gly125delinsAlaAlaAla L123A,L124A,G125A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain LLG AAA Wed May 02 18:32:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_leu_gly123-125ala_ala_ala' Tue Jun 30 17:36:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu123_Gly125delinsAlaAlaAla' O88838:p.Tyr141_Gln143delinsAlaAlaAla Y141A,H142A,Q143A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain YHQ AAA Wed May 02 18:14:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr_his_gln141-143ala_ala_ala' Tue Jun 30 17:16:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr141_Gln143delinsAlaAlaAla' O88838:p.Gln151_Tyr152delinsAlaAla Q151A, Y152A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain QY AA Fri Jul 28 10:53:16 BST 2017 This feature has been corrected as a result of our quality control procedures. The original label was 'gln_tyr151_152ala_ala' Wed May 02 20:31:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln_tyr151-152ala_ala' Tue Jun 30 18:12:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln151_Tyr152delinsAlaAla' O88838:p.Gly188_Pro189delinsAlaAla G188A, P189A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain GP AA Wed May 02 18:43:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly_pro188-189ala_ala' Tue Jun 30 15:59:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly188_Pro189delinsAlaAla' O88838:p.Val206Ala V206A mutation mutation disrupting mutation disrupting interaction mutation disrupting full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain V A This feature has been corrected as a result of our quality control procedures. The original label was 'V206A mutation'. Wed May 02 14:37:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val206ala' Tue Jun 30 15:51:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val206Ala' FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged full dna sequence full identification by DNA sequencing full dna sequence n-term range n-terminal range n-term range n-term range n-terminal range n-term range human Homo sapiens Human physical association physical association met-spsb2-1 3 9 unspecified role unspecified role bait bait human Homo sapiens Human 8 unspecified role unspecified role prey prey FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged full dna sequence full identification by DNA sequencing full dna sequence n-term range n-terminal range n-term range n-term range n-terminal range n-term range O88838:p.Leu123_Gly125delinsAlaAlaAla L123A,L124A,G125A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain LLG AAA Wed May 02 19:17:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu_leu_gly123-125ala_ala_ala' Tue Jun 30 19:54:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu123_Gly125delinsAlaAlaAla' O88838:p.Tyr141_Gln143delinsAlaAlaAla Y141A,H142A,Q143A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain YHQ AAA Wed May 02 19:22:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr_his_gln141-143ala_ala_ala' Tue Jun 30 15:51:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr141_Gln143delinsAlaAlaAla' O88838:p.Gln151_Tyr152delinsAlaAla Q151A, Y152A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain QY AA Wed May 02 15:26:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln_tyr151-152ala_ala' Tue Jun 30 17:06:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln151_Tyr152delinsAlaAla' O88838:p.Gly188_Pro189delinsAlaAla G188A, P189A mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain GP AA Wed May 02 14:55:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly_pro188-189ala_ala' Tue Jun 30 18:21:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly188_Pro189delinsAlaAla' human Homo sapiens Human physical association physical association