DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Nature structural & molecular biology 2005 imex curation Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. DIP original experiment: DIP-255120X Nature structural & molecular biology 2005 IMEx Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Nature structural & molecular biology 2005 imex curation Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. DIP original experiment: DIP-255113X Nature structural & molecular biology 2005 IMEx Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Nature structural & molecular biology 2005 imex curation Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. DIP original experiment: DIP-255119X Nature structural & molecular biology 2005 IMEx Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Nature structural & molecular biology 2005 imex curation Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. DIP original experiment: DIP-255117X Nature structural & molecular biology 2005 IMEx Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Nature structural & molecular biology 2005 imex curation Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. DIP original experiment: DIP-255112X Nature structural & molecular biology 2005 IMEx Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Nature structural & molecular biology 2005 imex curation Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. DIP original experiment: DIP-255111X Nature structural & molecular biology 2005 IMEx Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Nature structural & molecular biology 2005 imex curation Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. DIP original experiment: DIP-255118X Nature structural & molecular biology 2005 IMEx Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Nature structural & molecular biology 2005 imex curation Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. DIP original experiment: DIP-255114X Nature structural & molecular biology 2005 IMEx Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Nature structural & molecular biology 2005 imex curation Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. DIP original experiment: DIP-255116X Nature structural & molecular biology 2005 IMEx Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. Nature structural & molecular biology 2005 imex curation Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wu WH., Alami S., Luk E., Wu CH., Sen S., Mizuguchi G., Wei D., Wu C. DIP original experiment: DIP-255115X Nature structural & molecular biology 2005 IMEx Swc2 is a widely conserved H2AZ-binding module essential for ATP-dependent histone exchange. h2a1_yeast Histone H2A.1 HTA1 H2A1 SPT11 YDR225W YD9934.10 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRRGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKKSAKATKASQEL A908C94A0363D13F A908C94A0363D13F swr1_yeast Helicase SWR1 Swi2/Snf2-related 1 SWR1 YDR334W D9651.6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTTSRKSHAKDKKAGGEQDLADLKFRYDLLTNELFHLREFVSLVDYDPTHFNDSESFQKFLRETHLSLEERGEKFTDDVAKKGTNGDLTRRRRNLRTSTVVSSETTNEKKGDIELKLESIAPLVRNKCEELKYKLSDHSNRKSIVPQKRPIQHLKKREAAKSLKFKSERKENPLPLHEHIAEERYDHIAKVEEPSEAFTIKCPSDDSSFENTSEHYSDNFYFTTSSEEEDIKKKRGRKKKKPRIKLVVHPPKQTITNPLHVVKPGYESLHEYIASFKSLEDDLTLEEYNKYIDEQRRLLSRLKKGIENGALKYDKETDSLQPITSKEIKTIITYKPDPISYFYKQQDLQIHTDHLINQGIHMSKLFRSSTKARIARAKKVSQMIEQHFKHVAGAEERKAKEEERHKKSLARFAVQAVKKRWNMAEKAYRILRKDEEEQLKRIEGKQHLSKMLEKSTQLLEAQLNQVNDDGRSSTPSSDSNDVLSESDDDMDDELSTSSDEDEEVDADVGLENSPASTEATPTDESLNLIQLKEKYGHFNGSSTVYDSRNKDEKFPTLDKHESSSSESSVMTGEESSIYSSSENESQNENDRESDDKTPSVGLSALFGKGEESDGDLDLDDSEDFTVNSSSVEGEELEKDQVDNSAATFERAGDFVHTQNENRDDIKDVEEDAETKVQEEQLSVVDVPVPSLLRGNLRTYQKQGLNWLASLYNNHTNGILADEMGLGKTIQTISLLAYLACEKENWGPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKRKGWNKPDAFHVCIVSYQLVVQDQHSFKRKRWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRLLLTGTPLQNNLAELWSLLYFLMPQTVIDGKKVSGFADLDAFQQWFGRPVDKIIETGQNFGQDKETKKTVAKLHQVLRPYLLRRLKADVEKQMPAKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGNFMSIVNCLMQLRKVCNHPNLFEVRPILTSFVLEHCVASDYKDVERTLLKLFKKNNQVNRVDLDFLNLVFTLNDKDLTSYHAEEISKLTCVKNFVEEVNKLRETNKQLQEEFGEASFLNFQDANQYFKYSNKQKLEGTVDMLNFLKMVNKLRCDRRPIFGKNLIDLLTKDRRVKYDKSSIIDNELIKPLQTRVLDNRKIIDTFAVLTPSAVSLDMRKLALGLNDDSSVGENTRLKVMQNCFEVSNPLHQLQTKLTIAFPDKSLLQYDCGKLQKLAILLQQLKDNGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQILTERFNTDSRITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKKANQKRQLDNVVIQEGDFTTDYFSKLSVRDLLGSELPENASGGDKPLIADADVAAKDPRQLERLLAQAEDEDDVKAANLAMREVEIDNDDFDESTEKKAANEEEENHAELDEYEGTAHVDEYMIRFIANGYYY 156E3BB5978905C8 156E3BB5978905C8 vps72_drome Vacuolar protein sorting-associated protein 72 homolog CG4621 YL-1 Protein YL-1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAASRSRRNNAGNKIAHLLNEEEEDDFYKTSYGGFQEDEEDKEYEQKDEEEDVVDSDFSIDENDEPVSDQEEAPEKKRKRGVVNTKAYKETKPAVKKETKATPALHKKRPGGGVTKRRPRPRFTVLDSGRKSIRTSTAIKTQATKIRLKELDDARKRKKKKVRVEDYMPTQEELLEEAKITEEENTKSLEKFQKMELEKKKSRPTKRTFSGPTIRYHSLTMPAMRKPTRGANPAVDSKDLAGKCERTFVTIENDFNDKVFQSLFRHKAPPKASNGICPITRLPARYFDPITQQPYYSIQAFKILREAYYMQLEQQGGGSEQPELAKWLEWRKLVKENRLKASAAASKNGDN DIP protein Q9VKM6 original sequence version: 91 CB2D4B48CD09BDDE arp6_yeast Actin-like protein ARP6 ARP6 L2393 L9449.13 YLR085C protein protein yeast Saccharomyces cerevisiae Baker's yeast METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGPDWCTKHRFGYQNWI 92D201F62D04232B 92D201F62D04232B h2az_yeast Histone H2A.Z HTZ1 H2AZ YOL012C HTA3 O2345 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGKAHGGKGKSGAKDSGSLRSQSSSARAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHINKALLLKVEKKGSKK 1D8FCEE3C8A504E7 1D8FCEE3C8A504E7 vps72_yeast Vacuolar protein sorting-associated protein 72 SWR complex protein 2 VPS72 SWC2 YDR485C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDEGADKSLDTNTEFIIQTRSRRSNAGNKLQKLLEQELRDIESTKRQISSYKNGNDDEEDEIGLLFQEDEDDEDFEMMAKDDDDEGEEKEDETQSIRKEPSQASSEQAADDLMFSSSESEDSSNENDEDAEEKEIRRQELLSRKKRNKRLQKGPVVIKKQKPKPKSGEAIPRSHHTHEQLNAETLLLNTRRTSKRSSVMENTMKVYEKLSKAEKKRKIIQERIRKHKEQESQHMLTQEERLRIAKETEKLNILSLDKFKEQEVWKKENRLALQKRQKQKFQPNETILQFLSTAWLMTPAMELEDRKYWQEQLNKRDKKKKKYPRKPKKNLNLGKQDASDDKKRESEESIKNDGDVNSLGENSSSVHNQKRIEETSTNDTVEGESSPDAAVSRVNSDELKPTALPDVTLDAIANKQSTVDEAPNSQPQKNIITNEQKITNVGEPIQNLHNEEIKDEMVSALESRENTFENSSPAAQVVSQRDNSATPTPSNSTGTEDTILISPDTDIKGEPEPCLKTEGIENLSHNVPQETKSNTDVSFLKQVTFTDHPQVAIIDTEESPSKKDTANVDESSAENSLSTQTYEGPEQLTSRNFVTLYDFPNAPPNLKDFNTNLFGDRWSYTNGLSATQRPQDMKTVFHSILPSPPQSSVPSPTVDISLDLSALANFPSFGEYDKKIVHQINTEINKDLEIKIKTQPPTGVFLANGIRKKCLITNKECQYFDPRTGVPYSDVEAYKIIQRIQDPISKEEGRSDIKRDETTNEDSDDQVRFKWFGFKNGGIYLDLSQRPAKGVPEGF 6D3053EBB610DB95 6D3053EBB610DB95 vps71_yeast Vacuolar protein sorting-associated protein 71 YML041C YM8054.02C VPS71 SWC6 SWR complex protein 6 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKALVEEIDKKTYNPDIYFTSLDPQARRYTSKKINKQGTISTSRPVKRINYSLADLEARLYTSRSEGDGNSISRQDDRNSKNSHSFEERYTQQEILQSDRRFMELNTENFSDLPNVPTLLSDLTGVPRDRIESTTKPISQTSDGLSALMGGSSFVKEHSKYGHGWVLKPETLREIQLSYKSTKLPKPKRKNTNRIVALKKVLSSKRNLHSFLDSALLNLMDKNVIYHNVYNKRYFKVLPLITTCSICGGYDSISSCVNCGNKICSVSCFKLHNETRCRNR D95B57C72ACB648A D95B57C72ACB648A swc4_yeast SWR1-complex protein 4 SWC4 EAF2 GOD1 ESA1-associated factor 2 YGR002C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSDIFDVLNIKQKSRSPTNGQVSVPSSSAANRPKPQVTGMQRELFNLLGENQPPVVIKSGNNFKEKMLSTSKPSPWSFVEFKANNSVTLRHWVKGSKELIGDTPKESPYSKFNQHLSIPSFTKEEYEAFMNENEGTQKSVESEKNHNENFTNEKKDESKNSWSFEEIEYLFNLCKKYDLRWFLIFDRYSYNNSRTLEDLKEKFYYTCRNYFKASDPSNPLLSSLNFSAEKEIERKKYLQRLLSRSAAEIAEEEALVVESKKFEMAAKRTLAERESLLRLLDSPHSDQTITQYLTSQGMSQLYNALLADKTRKRKHDLNIPENPWMKQQQQFAQHRQLQQLNVKKSEVKENLSPKKTKRQRQEMQTALKRKSESAYAEQLLKDFNSDERKALGVITHGEKLSPGVYLRSTKLSTFKPALQNKILAILQELSLPSRPVMPSFDVMERQEELLKKINTLIDLKKHVDKYEAGMSITK 512CB8DF3171E7A3 512CB8DF3171E7A3 swc2-htz1-1 2 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association swr1-swc4-6 6 18 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait Region 278-681 Region 278-681 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association yl_1-h2a-1 7 11 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association swr1-htz1-1 5 15 unspecified role unspecified role prey prey HA-tag HA-tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 12 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association swc6-htz1-1 8 17 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 15 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association swc6-arp6-1 9 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association swc2-htz1-2 3 16 unspecified role unspecified role bait bait Region 1-281 Region 1-281 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 345-795 Region 345-795 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 15 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association yl_1-htz1-1 4 13 unspecified role unspecified role bait bait His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 15 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association swc2-h2a-1 1 11 unspecified role unspecified role prey prey Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role bait bait Region 1-281 Region 1-281 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Region 345-795 Region 345-795 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain His-tag His-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association swc2-arp6-1 10 14 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 17 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 16 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association